| Patents for C07K 16 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies (149,320) |
|---|
| 06/12/2008 | US20080138276 Monoclonal antibody produced by hybridoma with IDAC accession number 180706-02; competitive binding of monoclonal antibody, humanized-, chimeric- or cancerous disease modifying antibodies (CDMAB) with tissue sample induces cytotoxicity; anticarcinogenic, antitumor, and antimetastasis agents; diagnosis |
| 06/12/2008 | US20080138275 Hybridoma cell line G250 and its use for producing monoclonal antibodies |
| 06/12/2008 | CA2699837A1 Variant target binding agents and uses thereof |
| 06/12/2008 | CA2671633A1 Diagnostic agent for mesothelioma, diagnosis kit for mesothelioma, and diagnosis method for mesothelioma |
| 06/12/2008 | CA2671581A1 Peptides capable of binding to serum proteins |
| 06/12/2008 | CA2670897A1 Methods of treating systemic lupus erythematosus |
| 06/12/2008 | CA2670594A1 Interferon alpha-induced pharmacodynamic markers |
| 06/12/2008 | CA2670423A1 Recombinant antibodies against hepatitis c virus and methods of obtaining and using same |
| 06/12/2008 | CA2668947A1 Liquid anti-rabies antibody formulations |
| 06/12/2008 | CA2667574A1 Compositions and methods for binding sphingosine-1-phosphate |
| 06/12/2008 | CA2665371A1 Mn/ca9 splice variants |
| 06/11/2008 | EP1930728A1 Use of the mal protein as a tumour marker |
| 06/11/2008 | EP1930430A1 Method for specifically selecting antibody-producing cell |
| 06/11/2008 | EP1930429A1 Msx1/2, MARKERS OF GROWING PROGENITOR CELL OF DOPAMINE-PRODUCING NEURON |
| 06/11/2008 | EP1930420A1 Isolated nucleic acid molecules encoding a bacterial uracil phosphoribosyl-transferase enzyme, cells transformed therewith and uses thereof |
| 06/11/2008 | EP1930346A1 Antibody produced using ostrich and method for production thereof |
| 06/11/2008 | EP1930022A1 Treatment of bladder fibrosis with antibodies against alpha V beta 6 integrin |
| 06/11/2008 | EP1929309A2 Method for identifying therapeutics using biomarkers responsive to thiazolidinediones |
| 06/11/2008 | EP1929305A2 Reagents for the detection of protein phosphorylation in leukemia signaling pathways |
| 06/11/2008 | EP1929034A1 Cancerous disease modifying antibodies |
| 06/11/2008 | EP1929033A1 Cancerous disease modifying antibodies |
| 06/11/2008 | EP1928999A2 Methods of producing stable b-lymphocytes |
| 06/11/2008 | EP1928916A2 Immunomodulatory compositions and uses therefor |
| 06/11/2008 | EP1928915A2 An ultra-high yield intravenous immune globulin preparation |
| 06/11/2008 | EP1928914A2 Method for preparing immunoglobulin libraries |
| 06/11/2008 | EP1928913A2 Immunotherapeutic treatment for inducing the regression of atherosclerotic plaques |
| 06/11/2008 | EP1928911A2 Human fvii monoclonal antibodies binding the gla domain and use thereof |
| 06/11/2008 | EP1928910A1 A method for the mass production of immunoglobulin fc region deleted initial methionine residues |
| 06/11/2008 | EP1928905A2 Binding domains of proteins of the repulsive guidance molecule (rgm) protein family and functional fragments thereof, and their use |
| 06/11/2008 | EP1928506A2 Dual variable domain immunoglobin and uses thereof |
| 06/11/2008 | EP1928496A2 C/clp antagonists and methods of use thereof |
| 06/11/2008 | EP1928487A2 A novel peptide involved in energy homeostasis |
| 06/11/2008 | EP1670900A4 Enriched pancreatic stem cell and progenitor cell populations, and methods for identifying, isolating and enriching for such populations |
| 06/11/2008 | EP1391511B1 Artificial human chromosome containing human antibody lambda light chain gene |
| 06/11/2008 | EP1252191B1 Antibodies to suberic acid crosslinkers and methods for using the same |
| 06/11/2008 | EP1165113B1 USE OF ErbB RECEPTOR LIGANDS IN TREATING DIABETES |
| 06/11/2008 | EP1086137B1 Composition and method for modulating dendritic cell-t cell interaction |
| 06/11/2008 | EP0954529B1 Porphyromonas gingivalis antigens for the diagnosis and treatment of periodontitis |
| 06/11/2008 | CN101198698A Process for production of polypeptide by regulation of assembly |
| 06/11/2008 | CN101198625A Anti-IL-22RA antibodies and binding partners and methods of using in inflammation |
| 06/11/2008 | CN101198624A IL-31 monoclonal antibodies and methods of use |
| 06/11/2008 | CN101198623A Methods and compositions for modulating and detecting WISP activity |
| 06/11/2008 | CN101198374A Antibody or its fragment having anti-HIV neutralizing activity |
| 06/11/2008 | CN101195659A High anticoagulating active antihuman tissue factor monoclone antibody, preparation method and application thereof |
| 06/11/2008 | CN100393749C Antibody of EPSPS enzyme and its prepuration method and special antigen and application |
| 06/11/2008 | CN100393748C Human tumour necrosin antibody, its preparation and medicinal composition |
| 06/11/2008 | CN100393743C SARS early diagnostic method and reagent box |
| 06/11/2008 | CN100393356C Modified cytokines for use in cancer therapy |
| 06/10/2008 | USRE40374 immunomodulators comprising interleukins, Flt-3 ligands, CD antigens, interferons, colony stimulating factors, nucleotides and proteins coded by such nucleotides, antibodies raised against such proteins, used to elicit immune responses in mammals |
| 06/10/2008 | US7385107 Insect-resistant transgenic plants transformed with CryET33 and CryET34-encoding nucleic acids |
| 06/10/2008 | US7385040 contacting the solution with a chromatography resin containing a support to which multi-modal ligands have been immobilised ( N-hydroxysuccinimide activated agarose carrier coupled with 3-amino-4(propylsulfonyl)thiophene-2-carboxylic acid ligand) to adsorb antibodies and/or contaminants to the resin |
| 06/10/2008 | US7385039 Methods and compositions for regulating imidazoline receptors |
| 06/10/2008 | US7385038 pdCpA is bound to an amino acid such as phenylalanine, tryptophan or tyrosine or derivative allowed to react with 4,4-difluoro-5,7-dimethyl-4-bora-3a,4a-diaza-s-indecene-3-propionic acid label to form a labeled amino acid-pdCpA conjugate, which is then bound to tRNA(CA-); functional protein synthesis |
| 06/10/2008 | US7385035 Cytotoxic protein and utilization thereof |
| 06/10/2008 | US7385032 Bimer or an oligomer of a dimer, trimer, quadromer or pentamer of recombinant fusion proteins |
| 06/10/2008 | US7385031 PRO6097 polypeptides |
| 06/10/2008 | US7385030 For stimulating release of tumor necrosis factor and/or cellular proliferation/differentiation of chondrocyte/pericyte/endothelial cells by contacting blood with pro-polypeptide; tumor diagnosis |
| 06/10/2008 | US7385026 Modified ghrelin polypeptides |
| 06/10/2008 | US7385024 For therapy of proliferative diseases (particularly cancer), acromegaly or diabetic nephropathies and retinopathies |
| 06/10/2008 | US7384909 Anti-viral treatment methods using phosphatidylethanolamine-binding peptides linked to anti-viral agents |
| 06/10/2008 | US7384775 Comprises nucleotide sequences coding surface localized streptococcal polypeptides for design of vaccines for prevention of non-systemic diseases such as otitis media; genetic vaccines |
| 06/10/2008 | US7384768 Nucleic acids and polypeptides specific for pathogenic strains of the Neisseria genus |
| 06/10/2008 | US7384639 Methods of treating or preventing an infectious disease using an immunogenic conjugate of a gram-negative bacterial autoinducer molecule |
| 06/10/2008 | US7384633 Human type antihuman IgE receptor antibody and fragment |
| 06/10/2008 | US7384632 for prevention and/or treatment of cellular degeneration, including nerve cell damage associated with acute nervous cell system injury and chronic neurodegenerative diseases, including peripheral neuropathy |
| 06/10/2008 | US7384631 Contacting myeloid cells in a sample with a ligand directed against p75/AIRM1(75 kd adhesion inhibitory receptor molecule1) receptor, and determining binding of the ligand |
| 06/10/2008 | US7384630 Harvesting pancrea tissue; grafting into body cavity; increase insulin concentration |
| 06/10/2008 | CA2286330C Anti-vegf antibodies |
| 06/10/2008 | CA2229028C Colon cell and colon cancer cell associated nucleic acid molecules, protein and peptides |
| 06/10/2008 | CA2153756C Transport protein which effects the transport of cationic xenobiotics and/or pharmaceuticals, dna sequences encoding it and their use |
| 06/05/2008 | WO2008067497A2 Enriched antibody for detecting mycobacterial infection, methods of use and diagnostic test employing same |
| 06/05/2008 | WO2008067283A2 Ovr110 antibody compositions and methods of use |
| 06/05/2008 | WO2008067223A2 Il-17a/f heterodimeric polypeptides and therapeutic uses thereof |
| 06/05/2008 | WO2008066498A1 Cancer-related protein kinases |
| 06/05/2008 | WO2008066057A1 Control of cell proliferation targeted for iqgap3 |
| 06/05/2008 | WO2008065384A2 Antibodies specific for the complex of interleukin-6 and the interleukin-6 receptor |
| 06/05/2008 | WO2008065304A1 New drug for inhibiting, preventing or treatment of rheumatoid arthritis |
| 06/05/2008 | WO2008065053A1 Multi-modal cancer therapy using viral hitch-hiking |
| 06/05/2008 | WO2008064903A2 Antibody to the epitope grwirtqqhyyerdpkriyylslefymgrtlqntm or ifnqkivngwqveeaddwlrygnpwekarp or glgdvaevrksfnrhlhftlvkdrnvatprdyffa or dsmatlglaaygygiryefg |
| 06/05/2008 | WO2008046615A3 Anti-ige vaccines |
| 06/05/2008 | WO2008039818A3 Modified t cell receptors and related materials and methods |
| 06/05/2008 | WO2008037257A3 Anti-cd38 plus corticosteroids plus a non-corticosteroid chemotherapeutic for treating tumors |
| 06/05/2008 | WO2007118214A3 Antibody compositions and methods for treatment of neoplastic disease |
| 06/05/2008 | WO2007112146A3 Antibodies against thymic stromal lymphopoietin receptor for treating allergic diseases |
| 06/05/2008 | WO2007106915A3 Antibodies to egfl7 and methods for their use |
| 06/05/2008 | US20080134369 Nucleic acid molecules and other molecules associated with plants |
| 06/05/2008 | US20080134354 Protein Regulating Leaf Longevity of Plants, the Gene Thereof and Their Use |
| 06/05/2008 | US20080132686 Monoclonal antibody which binds insulin-like growth factor receptor (IGF-IR ) for use in diagnosis, prevention and treatment of cell proliferative disorders; antitumor agents |
| 06/05/2008 | US20080132685 Methods and Compositions for Detecting Amyotrophic Lateral Sclerosis |
| 06/05/2008 | US20080132684 High throughput screening; immunoassays; immunogens; antibodies producing uridine diphosphate with higher affinity to carbohydrates |
| 06/05/2008 | US20080132683 Purification of immunoglobulins from solution (hybridoma cell culture supernatants, animal plasma or sera, or colostrum); solid phase synthesis |
| 06/05/2008 | US20080132462 Administering an agent which inhibits the expression or activity of p46 Shc and/or p52 Shc; determining whether an agent inhibits the phosphorylation of p46 Shc or p52 Shc |
| 06/05/2008 | US20080132452 treating a an autoimmune condition; administering polypeptide; Goodpasture Syndrome, multiple sclerosis, systemic lupus erythematosus, cutaneous lupus erythematosus, pemphigus, pemphigoid and lichen planus |
| 06/05/2008 | US20080131976 Novel G protein coupled receptor protein, DNA its ligand |
| 06/05/2008 | US20080131962 Engineered cleavage half-domains |
| 06/05/2008 | US20080131931 Expression vector comprising nucleotide sequences coding protein which binds interleukin-10 related t cell-derived inducible factor (IL-TIF); for use in targeting cell for surgical removal |
| 06/05/2008 | US20080131915 GPR30 estrogen receptor in breast cancers |
| 06/05/2008 | US20080131912 Recombinant antibodies against hepatitis C virus and methods of obtaining and using same |
| 06/05/2008 | US20080131910 Transcription factor specific immunoglobulin for use in treatment and prevention of cell proliferative, respiratory, kidney and liver disorders |
| 06/05/2008 | US20080131908 Novel anti-notch3 antibodies and their use in the detection and diagnosis of disease |