| Patents for C07K 16 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies (149,320) |
|---|
| 07/22/2008 | US7402729 Human artificial chromosome containing human antibody λ light chain gene and non-human animal containing the human artificial chromosome capable of genetic transmission |
| 07/22/2008 | US7402666 Vaccine based on fact that a significant proportion of canine and feline tumours express an oncofetal leucine-rich glycoprotein, known as "5T4" |
| 07/22/2008 | US7402663 Obesity, antidiabetic agents |
| 07/22/2008 | US7402662 Antibody molecules specific to human tumor necrosis factor alpha |
| 07/22/2008 | US7402661 PRO polypeptides; monoclonal/humanized antibodies; fusion proteins |
| 07/22/2008 | US7402660 Inhibiting neoangiogenesis by administering a molecule with an antibody variable region which specifically binds to an extracellular domain of a TEM protein |
| 07/22/2008 | US7402658 TRAIN-R: a cysteine-rich member of the TNF-receptor family |
| 07/22/2008 | US7402657 C-C chemokine receptor 3 proteins |
| 07/22/2008 | US7402570 kits for detecting amplification or elevated expression for diagnosis; genetic engineering; solid phase synthesis |
| 07/22/2008 | US7402563 EPF derived peptides and therapeutic compositions |
| 07/22/2008 | US7402560 oligopeptides capable of stimulating the proliferation or/and the outgrowth from cells presenting the neural cell adhesion molecule (NCAM), used for treatment of normal, degenerated and damaged NCAM presenting cells |
| 07/22/2008 | US7402557 Reducing epithelial toxicity such as a skin rash or diarrhea during cancer therapy, by coadministering KGF with erlotinib (N-(3-ethynylphenylamino)-6,7-bis(2-methoxyethoxy)-4-quinazoline amine) |
| 07/22/2008 | US7402410 Humanized immunoglobulin reactive with α4β7 integrin |
| 07/22/2008 | US7402401 Determining whether ST receptor protein or mRNA encoding it is present in lymph node; polymerase chain reaction and binding assay |
| 07/22/2008 | US7402400 Membrane protein for use in quality control in food processing |
| 07/22/2008 | US7402398 Measuring receptor homodimerization |
| 07/22/2008 | US7402388 Using immunophilin (FKBP54) expression as diagnostic/prognostic indicator of cell proliferative disorders; antitumor agents |
| 07/22/2008 | US7402315 Peptide of given sequence; fused to glutathione-S-transferase; use in immunoassays and vaccines |
| 07/22/2008 | US7402314 Antigen peptides; medical diagnosis |
| 07/22/2008 | US7402313 Calculating a suitable dosage of digoxin immune fab, administering by intravenous bolus and repeating |
| 07/22/2008 | US7402312 Immunoglobulin mixture specific to endothelial growth factor for use as tools in treatment and prevention of cell prolifreative disorders; antitumor agents |
| 07/22/2008 | US7402305 Comprises nucleotide sequences coding protein with antiproliferative and viricidal activity for use in treatment and prevention of cancer, nervous system, bone and autoimmune disorders |
| 07/22/2008 | CA2173324C Hybridoma and anti-kc-4 humanized monoclonal antibody, dna and rna encoding it, kit, diagnostic and therapeutic methods |
| 07/22/2008 | CA2017025C Tumor necrosis factor binding protein ii, its purification and antibodies thereto |
| 07/17/2008 | WO2008086395A2 Anti-il-13 antibody formulations and uses thereof |
| 07/17/2008 | WO2008086221A2 Enhanced oil recovery compositions comprising proteins and surfactants and methods of using the same |
| 07/17/2008 | WO2008085951A2 Treatment of tumors by ablating bone marrow-derived endothelial progenitor cells |
| 07/17/2008 | WO2008085878A2 High affinity antibodies that neutralize staphylcoccus enterotoxin b |
| 07/17/2008 | WO2008085551A2 Smallpox monoclonal antibody |
| 07/17/2008 | WO2008084710A1 Inhibitor of herpesvirus infection, method for inhibition of herpesvirus infection, and use thereof |
| 07/17/2008 | WO2008084402A2 Diagnosis and treatment of alzheimer's and other neurodementing diseases |
| 07/17/2008 | WO2008084106A1 Anti-kir antibodies, formulations, and uses thereof |
| 07/17/2008 | WO2008083998A1 In vitro method for diagnosing prostate cancer |
| 07/17/2008 | WO2008083949A2 Rna-coded antibody |
| 07/17/2008 | WO2008083493A1 Stabilization of cyclic peptide structures |
| 07/17/2008 | WO2008083432A1 Recombinant antibodies |
| 07/17/2008 | WO2008067497A3 Enriched antibody for detecting mycobacterial infection, methods of use and diagnostic test employing same |
| 07/17/2008 | WO2008067283A9 Ovr110 antibody compositions and methods of use |
| 07/17/2008 | WO2008067223A9 Il-17a/f heterodimeric polypeptides and therapeutic uses thereof |
| 07/17/2008 | WO2008066691A3 Tes7 and antibodies that bind thereto |
| 07/17/2008 | WO2008064903A3 Antibody to the epitope grwirtqqhyyerdpkriyylslefymgrtlqntm or ifnqkivngwqveeaddwlrygnpwekarp or glgdvaevrksfnrhlhftlvkdrnvatprdyffa or dsmatlglaaygygiryefg |
| 07/17/2008 | WO2008055206A9 Humanized anti-factor d antibodies |
| 07/17/2008 | WO2008052187A3 Antibodies and immunoconjugates and uses therefor |
| 07/17/2008 | WO2008044076A3 Therapy targeting cathepsin s |
| 07/17/2008 | WO2008028601A3 Method for improving the specific effector function of single-chain antigen-recognizing genetic constructs (scarc) through murinization thereof |
| 07/17/2008 | WO2008010101A3 Antagonist antibody against epha2 for the treatment of cancer |
| 07/17/2008 | WO2007145760A3 Anthrax compositions and methods of use and production |
| 07/17/2008 | WO2007139972A8 Expression of the cysteine protease legumain in vascular and inflammatory diseases |
| 07/17/2008 | WO2007112047A3 Formulations containing immunotoxins targeted to the mesothelin tumor cell antigen |
| 07/17/2008 | WO2007097812A3 Therapeutic anti-her2 antibody fusion polypeptides |
| 07/17/2008 | WO2007066109A8 Bispecific ligands with binding specificity to cell surface targets and methods of use therefor |
| 07/17/2008 | WO2004081029A3 Novel non-invasive marker for liver disease |
| 07/17/2008 | US20080172763 Nod-Factor Perception |
| 07/17/2008 | US20080171856 Antibodies; tissue-targeted therapy; for treatment of tumors, autoimmune diseases, graft rejections, graft versus host disease, viral infections, parasite infections |
| 07/17/2008 | US20080171855 Polyvalent protein complex |
| 07/17/2008 | US20080171702 Novel gene and uses therefor |
| 07/17/2008 | US20080171352 Using cytokine profile to diagnose cancer, cardiovascular, inflammatory, autoimmune, neurological, infectious and pregnancy related disorders |
| 07/17/2008 | US20080171341 Detection of conformationally altered proteins and prions |
| 07/17/2008 | US20080171339 Novel members of the capsaicin/vanilloid receptor family of proteins and uses thereof |
| 07/17/2008 | US20080171328 Vertebrate hedgehog polypeptide for use as tools in identifying modulators for use in treatment and prevention of nervous system disorders |
| 07/17/2008 | US20080171313 Identifying nucleoside resistant hepatitis b virus based on presence of mutation in polymerase gene |
| 07/17/2008 | US20080171061 Using lentiviral peptide to ellicit CD8+ lymphocyte response to treat and prevent viral infection and viral associated cell proliferative disorders |
| 07/17/2008 | US20080171056 Enhancing therapeutic efficacy of antitumor agents via concurrent expose to receptor specific immunoglobulins; tissue targeted therapy |
| 07/17/2008 | US20080171054 Immunoglobulin for use in detection, prevention and treatment of methicillin-resistant staphylococcus aureus (MRSA) infection |
| 07/17/2008 | US20080171052 Hmgb1 protein inhibitorsand/or antagonists for the treatment of vascular diseases |
| 07/17/2008 | US20080171046 Novel proteins and nucleic acids encoding same |
| 07/17/2008 | US20080171045 Compositions and Methods for Diagnosing and Treating Cancer |
| 07/17/2008 | US20080171044 Compositions and methods for inhibiting squamous cell carcinoma |
| 07/17/2008 | US20080171043 Cytotoxin conjugated immunoglobulin specific to tripeptide sequence (N'-Trp-Pro-Ile-C') of carcinoembryonic antigen for use in treatment and prevention of cell proliferative disorders |
| 07/17/2008 | US20080171041 Method for treating inflammation |
| 07/17/2008 | US20080171040 Antibody-drug conjugates and methods |
| 07/17/2008 | US20080171039 Zinc transporter protein (LIV-1) specific imunoglobulin for use in prevention and treatment of breast cancer |
| 07/17/2008 | US20080171037 Tumor necrosis factor receptor ligand for use in identifying modulators for prevention and treatment of cell proliferative, nervous system, cardiovascular and autoimmune disorders |
| 07/17/2008 | US20080171036 Using tumor necrosis factor specific immuoglobulin for diagnosis, treatment and prevention of inflammatory, cell proliferative, skin, respiratory system, nervous system and infectious disorders |
| 07/17/2008 | US20080171035 Mammalian cell membrane proteins; related reagents |
| 07/17/2008 | US20080171017 Therapeutic mixture comprising chimeric interleukin receptor, microbiocidal, antiproliferative and chemotherapeutic agent for use in treatment and prevention of infectious and cancer disorders |
| 07/17/2008 | US20080171016 Death Domain Containing Receptors |
| 07/17/2008 | US20080171014 Interleukin-13 binding proteins |
| 07/17/2008 | CA2675291A1 Killer ig-like receptor (kir) antibodies, formulations, and uses thereof |
| 07/17/2008 | CA2675024A1 Stabilization of cyclic peptide structures |
| 07/17/2008 | CA2674739A1 In vitro method for diagnosing prostate cancer |
| 07/17/2008 | CA2674608A1 Anti-il-13 antibody formulations and uses thereof |
| 07/17/2008 | CA2674603A1 Sp35 antibodies and uses thereof |
| 07/17/2008 | CA2674382A1 High affinity antibodies that neutralize staphylcoccus enterotoxin b |
| 07/17/2008 | CA2674378A1 Methods and compositions related to clot binding compounds |
| 07/17/2008 | CA2674356A1 Enhanced capacity and purification of antibodies by mixed mode chromatography in the presence of aqueous-soluble nonionic organic polymers |
| 07/17/2008 | CA2673755A1 Human cytomegalovirus neutralising antibodies and use thereof |
| 07/16/2008 | EP1944610A1 Engineering affinity ligands for macromolecules |
| 07/16/2008 | EP1944609A1 In vitro method for diagnosing prostate cancer |
| 07/16/2008 | EP1944371A2 Neisseria meningitidis antigens and compositions |
| 07/16/2008 | EP1944370A1 New voltage-dependent potassium channel and its use to develop therapeutic medicine |
| 07/16/2008 | EP1944323A1 Novel monoclonal antibody and use thereof |
| 07/16/2008 | EP1944322A2 Treatment of TNF alpha related disorders |
| 07/16/2008 | EP1944321A2 Methods and compositions for determining the purity of chemically synthesized nucleic acids |
| 07/16/2008 | EP1944320A1 Immunoglobulin variants and uses thereof |
| 07/16/2008 | EP1944319A1 T1R Taste Receptors and Genes Encoding Same |
| 07/16/2008 | EP1944317A2 Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| 07/16/2008 | EP1944315A1 Prophylaxis and therapy of alzheimer's disease and other neurodementing diseases |
| 07/16/2008 | EP1944311A1 Benzimidazole compounds and their use as chromatographic ligands |
| 07/16/2008 | EP1944040A2 Assay method for Alzheimer's disease |