| Patents for G01N 33 - Investigating or analysing materials by specific methods not covered by groups (393,632) |
|---|
| 03/05/2009 | US20090061420 Mutational profiles in hiv-1 protease correlated with phenotypic drug resistance |
| 03/05/2009 | US20090061418 Disposable analytical microprocessor device |
| 03/05/2009 | US20090061416 Surfaces and methods for biosensor cellular assays |
| 03/05/2009 | US20090061414 Method for quantification of recombinant viruses |
| 03/05/2009 | US20090061411 Analysis of sulfated polysaccharides |
| 03/05/2009 | US20090061055 System and method for measuring starch gelatinization |
| 03/05/2009 | US20090061015 Regulation of Protein Activity By Reversible Acetylation |
| 03/05/2009 | US20090060980 Glycan binding proteins as therapeutic targets for retinal disorders and treatment methods based thereon |
| 03/05/2009 | US20090060932 Immunizing an animal against Lyme disease by administering composition of at least two OspC polypeptides from Lyme Disease causing Borrelia comprising unlipidated and lipidated OspC polypeptides |
| 03/05/2009 | US20090060929 Gene therapy and vaccination; non-viral transfection complex of a nucleic acid, optionally, a lipid,a polycationic nucleic acid-binding component, and a cell surface receptor binding peptide of given sequence |
| 03/05/2009 | US20090060925 Rage Fusion Proteins and Methods of Use |
| 03/05/2009 | US20090060900 Methods for Screening Compounds That Modulate Lipid Metabolism |
| 03/05/2009 | US20090060899 Composition of organic compounds |
| 03/05/2009 | US20090060787 introducing an analyte fluid having a flow to a surface of a sample chip through a microfluidic device, maintaining the flow of the analyte fluid such that the analyte fluid forms a pattern on the surface of the sample chip, the pattern approximating the semi-circular groove |
| 03/05/2009 | US20090060786 Microfluidic apparatus for wide area microarrays |
| 03/05/2009 | US20090060783 Polymer concentration monitoring system and use thereof |
| 03/05/2009 | US20090060303 Method and apparatus for automated image analysis of biological specimens |
| 03/05/2009 | US20090059995 Method For Recording The Boiling Curve Of Liquids And Device For Carrying Out The Method |
| 03/05/2009 | US20090059203 Apparatus For Measuring Concentration of a Specific Ingredient In-Situ |
| 03/05/2009 | US20090059202 Sample analyzer and sample analyzing method |
| 03/05/2009 | US20090058428 Method and device for monitoring and controlling fluid locomotion |
| 03/05/2009 | US20090057550 Systems and methods for discovery and analysis of markers |
| 03/05/2009 | US20090057148 In Vivo Analyte Monitor With Malfunction Detection |
| 03/05/2009 | US20090057147 Devices and methods for biochip multiplexing |
| 03/05/2009 | US20090057146 Analyte test strip with improved reagent deposition |
| 03/05/2009 | US20090056480 Apparatus and method for determining mineral content |
| 03/05/2009 | US20090056422 Salometer and flow rate sensor assembly |
| 03/05/2009 | US20090056421 Residual Liquid Quantity Detecting Method |
| 03/05/2009 | US20090056419 High efficiency, low loss no to no2 catalytic converter |
| 03/05/2009 | US20090056409 Gasless calibration in metabolic gas analyzers |
| 03/05/2009 | US20090056408 Portable metered flow apparatus for calibration/bump testing |
| 03/05/2009 | US20090056120 Biosensor and method of making |
| 03/05/2009 | DE10337772B4 Immunoassay und Nachweisverfahren Immunoassay and detection methods |
| 03/05/2009 | DE102008033562A1 Purifying an interaction partner of a protein from a sample containing a complex of the two comprises gel filtration, native gel electrophoresis and denaturing gel electrophoresis |
| 03/05/2009 | DE102007058407A1 Antikörper gegen die Epitope GRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM oder IFNQKIVNGWQVEEADDWLRYGNPWEKARP oder GLGDVAWVRKSFNRHLHFTLVKDRNVATPRDYFFA oder DSMATLGLAAYGYGIRYEFG Antibodies against epitopes GRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM or IFNQKIVNGWQVEEADDWLRYGNPWEKARP or GLGDVAWVRKSFNRHLHFTLVKDRNVATPRDYFFA or DSMATLGLAAYGYGIRYEFG |
| 03/05/2009 | DE102007041279A1 Biosensor arrangement manufacturing method for e.g. amperometric and potentiometric pharmacological active site testing, involves exposing carrier to force for period, where carrier comprises component perpendicular to part of region |
| 03/05/2009 | DE10023423B4 Direkter Nachweis von Einzelmolekülen Direct detection of single molecules |
| 03/05/2009 | CA2734029A1 Methods for determining the concentration of an analyte in solution |
| 03/05/2009 | CA2715103A1 Monoclonal antibody which binds met in formalin-fixed and paraffin-embedded tissues and related methods |
| 03/05/2009 | CA2698318A1 Compositions and means for diagnosing microbial infections |
| 03/05/2009 | CA2698202A1 Method for identifying oculoskeletal dysplasia in dogs |
| 03/05/2009 | CA2697976A1 A process for producing a peptide hormone |
| 03/05/2009 | CA2697951A1 Amino acid pairing-based self assembling peptides and methods |
| 03/05/2009 | CA2697529A1 Receptor-targeting reagents |
| 03/05/2009 | CA2697499A1 Mercury measuring apparatus for measuring mercury contained in sample composed mainly of hydrocarbon |
| 03/05/2009 | CA2697480A1 Detection of bacteria belonging to the genus campylobacter by targeting cytolethal distending toxin |
| 03/05/2009 | CA2697448A1 Dendritic cell marker and uses thereof |
| 03/05/2009 | CA2697413A1 Modulators of hypersensitivity reactions |
| 03/05/2009 | CA2697363A1 Modulation of synaptogenesis |
| 03/05/2009 | CA2697361A1 Alpha-synuclein binding diagnostic agent |
| 03/05/2009 | CA2697151A1 Use of cyanocinnamic acid derivatives as matrices in maldi mass spectrometry |
| 03/05/2009 | CA2697070A1 Methods of inhibiting tumor growth using beta 5 integrin antagonists |
| 03/05/2009 | CA2696783A1 Nanofibers with high enzyme loading for highly sensitive biosensors |
| 03/05/2009 | CA2695213A1 Sensor |
| 03/05/2009 | CA2685714A1 Inducible mutagenesis of target genes |
| 03/04/2009 | EP2031533A1 System, method and computer program for non-binary sequence comparison |
| 03/04/2009 | EP2031406A2 Automatic multidisciplinary analyser for in vitro diagnosis |
| 03/04/2009 | EP2031402A1 Reagent and method for measuring coagulation time of blood sample. |
| 03/04/2009 | EP2031401A1 Automated protein analysis method |
| 03/04/2009 | EP2031400A1 Automated Protein Analysis method |
| 03/04/2009 | EP2031399A1 Automated protein analysis method |
| 03/04/2009 | EP2031398A1 Alzheimer's disease-specific alterations of the ERK1/ERK2 phosphorylation ratio as Alzheimer's disease-specific molecular biomarkers (ADSMB) |
| 03/04/2009 | EP2031397A1 Surfactant proteins B and D in differentiating the causes of shortness of breath |
| 03/04/2009 | EP2031395A1 Biomolecular substrate and test device |
| 03/04/2009 | EP2031394A1 Method for purifying bioactive substances |
| 03/04/2009 | EP2031393A1 Sensor element for spr measurement |
| 03/04/2009 | EP2031392A1 Use of glycosaminoglycans to reduce non-specific binding in immunoassays |
| 03/04/2009 | EP2031390A1 Stabilizing agent and blocking agent |
| 03/04/2009 | EP2031389A1 Vial |
| 03/04/2009 | EP2031377A1 Automatic optical inspection apparatus for fabrics |
| 03/04/2009 | EP2031376A2 Assay device with shared zones |
| 03/04/2009 | EP2031372A1 Device for determining the concentration of a substance present in a solution, using ellipsometry |
| 03/04/2009 | EP2031366A2 Automated protein analyzer |
| 03/04/2009 | EP2031076A1 Novel compositions and methods for cancer |
| 03/04/2009 | EP2031075A1 Molecular differences between species of the M. Tuberculosis complex |
| 03/04/2009 | EP2031074A1 Method of detecting variation and kit to be used therein |
| 03/04/2009 | EP2031063A2 Modulators of odorant receptors |
| 03/04/2009 | EP2031062A1 Dna encoding polypeptide capable of modulating muscle-specific tyrosine kinase activity |
| 03/04/2009 | EP2031010A1 Method for production of novel nano silica particle and use of the nano silica particle |
| 03/04/2009 | EP2030986A1 Polypeptide derivative of parathyroid hormone (PTH) |
| 03/04/2009 | EP2030677A2 Biosensor chip, process for producting the same, and sensor for surface plasmon resonance analysis |
| 03/04/2009 | EP2030033A1 Sensor device with adaptive field compensation |
| 03/04/2009 | EP2030026A2 Improved measurement of vitamin d |
| 03/04/2009 | EP2030025A2 Markers associated with arteriovascular events and methods of use thereof |
| 03/04/2009 | EP2030024A1 G protein coupled receptor 39 (gpr39) |
| 03/04/2009 | EP2030023A1 In vitro multiparameter determination method for the diagnosis and early diagnosis of neurodegenerative disorders |
| 03/04/2009 | EP2030022A1 Use of lysosomal carboxypeptidase c (prcp) as a therapeutic or diagnostic target |
| 03/04/2009 | EP2030021A2 Method for diagnosing mitochondrial dysfunction |
| 03/04/2009 | EP2030020A2 Aptamers directed to recombinant muc1 |
| 03/04/2009 | EP2030019A2 Microelectronic sensor device with washing means |
| 03/04/2009 | EP2030018A1 Reverse phase protein array, protein activation and expression signatures, and associated methods |
| 03/04/2009 | EP2030017A1 Method and kit for the detection of heparin-dependent antibodies and the diagnosis of immune or autoimmune pathologies potentiated by heparin such as heparin-induced thrombocytopenia |
| 03/04/2009 | EP2030016A2 Methods and compositions for modulating hepsin activation of urokinase-type plasminogen activator |
| 03/04/2009 | EP2030014A1 IN VITRO ASSAY BASED ON cAMP LEVELS MODULATED BY Gi-COUPLED RECEPTORS |
| 03/04/2009 | EP2030013A1 Ready-to-use whole blood collection vessel |
| 03/04/2009 | EP2030012A1 Amperometric sensor and method for its manufacturing |
| 03/04/2009 | EP2030011A2 Systems and methods for analyzing nanoreporters |
| 03/04/2009 | EP2029999A2 Methods for flow cytometry analyses of cells without lysing subpopulations |
| 03/04/2009 | EP2029778A2 Diagnosis of fetal abnormalities using polymorphisms including short tandem repeats |
| 03/04/2009 | EP2029771A1 Diagnostic method for myopathy |