Patents
Sitemap › C12 - Biochemistry; Beer; Spirits; Wine; Vinegar; Microbiology; Enzymology; Mutation or genetic engineering › C12Q - Measuring or testing processes involving enzymes or micro-organisms; Compositions or test papers therefor; Processes of preparing such compositions; Condition-responsive control in microbiological or enzymological processes › C12Q 1 - Measuring or testing processes involving enzymes or micro-organisms; Compositions therefor; Processes of preparing such compositions
Patents for C12Q 1 - Measuring or testing processes involving enzymes or micro-organisms; Compositions therefor; Processes of preparing such compositions (300,231)
03/2009
03/05/2009US20090061449 Systems and methods for processing hybrid seed
03/05/2009US20090061448 Method for identifying oculoskeletal dysplasia in dogs
03/05/2009US20090061447 High speed parallel molecular nucleic acid sequencing
03/05/2009US20090061446 Method for quickly identifying pathogenic bacteria responsible for infection
03/05/2009US20090061445 Flux balance analysis with molecular crowding
03/05/2009US20090061444 Phytochrome-based fluorophores
03/05/2009US20090061443 Diagnostic and Therapeutic Targets for Leukemia
03/05/2009US20090061442 Screening assay to identify non-ATP-competitors targeting protein kinase A
03/05/2009US20090061441 Epigenetic silencing of cyclooxygenase-2 affects clinical outcome in gastric cancer
03/05/2009US20090061440 Method for amplifying plural nucleic acid sequences for discrimination
03/05/2009US20090061439 Methods and Compositions for Sequencing A Nucleic Acid
03/05/2009US20090061438 Detection of microsatellite instability and its use in diagnosis of tumors
03/05/2009US20090061437 Nucleotide Analogs
03/05/2009US20090061436 Peptide sequence that promotes tumor invasion
03/05/2009US20090061435 combining the sample in a reaction vessel with a first primer and a second primer having a first section, a second section and a spacer; used in biodefense and Point of Care clinical diagnostics
03/05/2009US20090061434 for distinguishing and identification of different species of Phyllanthus (Phyllanthus amarus, Phyllanthus fraternus, Phyllanthus debilis, Phyllanthus urinaria); the treatment of liver disorders and urinary infections
03/05/2009US20090061433 Nucleotide primer set and nucleotide probe for detecting genotype of serum amyloid a1(saa1)
03/05/2009US20090061432 Cspcna isoform modifications and uses thereof
03/05/2009US20090061431 Method of prognosing and diagnosing hereditary spastic paraplegia, mutant nucleic acid molecules and polypeptides
03/05/2009US20090061430 Reactive surfaces, substrates and methods of producing and using same
03/05/2009US20090061429 Reactive surfaces, substrates and methods of producing and using same
03/05/2009US20090061428 Thermal Reaction Device and Method for Using the Same
03/05/2009US20090061427 Gene Encoding Protein Responsible for Flocculation Property of Yeast and Use Thereof
03/05/2009US20090061426 Forming a polymerase complex between two or more analyte specific probes (ASP) and an analyte; complex then generates a detectable signal which is indicative of the presence and/or amount of the analyte in the sample
03/05/2009US20090061425 Methods and kits for selectively amplifying, detecting or quantifying target DNA with specific end sequences
03/05/2009US20090061424 Universal ligation array for analyzing gene expression or genomic variations
03/05/2009US20090061423 Pharmacogenomic markers for prognosis of solid tumors
03/05/2009US20090061422 Diagnostic markers of breast cancer treatment and progression and methods of use thereof
03/05/2009US20090061421 used to develop novel antibiotics or inhibitors that can prevent an emergence of resistance bacteria; Enterobacter aerogenes
03/05/2009US20090061420 Mutational profiles in hiv-1 protease correlated with phenotypic drug resistance
03/05/2009US20090061419 Genomic markers of hepatitis b virus associated with hepatocellular carcinoma
03/05/2009US20090061418 Disposable analytical microprocessor device
03/05/2009US20090061417 Influenza a virus detection method and kit therefore
03/05/2009US20090061416 Surfaces and methods for biosensor cellular assays
03/05/2009US20090061415 Sequences Diagnostic For Shrimp Pathogens
03/05/2009US20090061414 Method for quantification of recombinant viruses
03/05/2009US20090061413 Isothermal screening of hiv-1 related nucleic acids
03/05/2009US20090061412 Methods for Detecting Papillomavirus DNA in Blood Plasma and Serum
03/05/2009US20090061411 Analysis of sulfated polysaccharides
03/05/2009US20090060929 Gene therapy and vaccination; non-viral transfection complex of a nucleic acid, optionally, a lipid,a polycationic nucleic acid-binding component, and a cell surface receptor binding peptide of given sequence
03/05/2009US20090060903 administering Noggin proteins to reduce teratogenicity of antineoplastic agents; antibodies
03/05/2009US20090060902 Methods and compositions for regulating T cell subsets by modulating transcription factor activity
03/05/2009US20090060900 Methods for Screening Compounds That Modulate Lipid Metabolism
03/05/2009US20090060899 Composition of organic compounds
03/05/2009US20090060797 Fluid control structures in microfluidic devices
03/05/2009US20090057147 Devices and methods for biochip multiplexing
03/05/2009US20090056120 Biosensor and method of making
03/05/2009DE102007058407A1 Antikörper gegen die Epitope GRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM oder IFNQKIVNGWQVEEADDWLRYGNPWEKARP oder GLGDVAWVRKSFNRHLHFTLVKDRNVATPRDYFFA oder DSMATLGLAAYGYGIRYEFG Antibodies against epitopes GRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM or IFNQKIVNGWQVEEADDWLRYGNPWEKARP or GLGDVAWVRKSFNRHLHFTLVKDRNVATPRDYFFA or DSMATLGLAAYGYGIRYEFG
03/05/2009DE102007041864A1 Verfahren zum Nachweis von Bakterien und Pilzen A method for the detection of bacteria and fungi
03/05/2009DE102007041835A1 Diagnosesubstanz zur Anwendung in einem Verfahren zur Diagnose von pathologischem Gewebe und ein Verfahren zur Herstellung einer solchen Diagnosesubstanz Diagnostic substances for use in a method of diagnosis of pathological tissue, and a method of making such a diagnostic substance
03/05/2009DE102007041655A1 Vermehrung von primären Zellen und deren Verwendung Multiplication of primary cells and their use
03/05/2009DE102007041236A1 Verfahren zur Feststellung der Sensitivität von Tumoren gegenüber Capecitabin und Testkit Procedure for determining the sensitivity of tumors to capecitabine and test kit
03/05/2009DE10023423B4 Direkter Nachweis von Einzelmolekülen Direct detection of single molecules
03/05/2009CA2701193A1 A method for predicting susceptibility to a mental disorder
03/05/2009CA2698318A1 Compositions and means for diagnosing microbial infections
03/05/2009CA2697860A1 Methods and compositions for breeding for preferred traits
03/05/2009CA2697480A1 Detection of bacteria belonging to the genus campylobacter by targeting cytolethal distending toxin
03/05/2009CA2697156A1 Composition comprising an oligonucleotide mixture for improved detection of human papillomavirus genotypes
03/05/2009CA2695378A1 Application of anaerobic denitrifying bacteria utilizing petroleum components as sole carbon source for oil recovery
03/05/2009CA2694914A1 Method for identification of novel anaerobic denitrifying bacteria utilizing petroleum components as sole carbon source
03/04/2009EP2031076A1 Novel compositions and methods for cancer
03/04/2009EP2031075A1 Molecular differences between species of the M. Tuberculosis complex
03/04/2009EP2031074A1 Method of detecting variation and kit to be used therein
03/04/2009EP2031073A1 Diagnostic of immune graft tolerance using TMTC3 gene expression levels
03/04/2009EP2031072A1 Method for in-vitro diagnosing a predisposition to smoking and a pharmaceutical composition for treating tobacco abuse
03/04/2009EP2031071A1 Method for categorizing samples containing spermatozoa by molecular profiling
03/04/2009EP2031070A1 Multiplex amplification of polynucleotides
03/04/2009EP2031063A2 Modulators of odorant receptors
03/04/2009EP2031062A1 Dna encoding polypeptide capable of modulating muscle-specific tyrosine kinase activity
03/04/2009EP2031058A1 Method of synthesizing polynucleotide
03/04/2009EP2031056A1 Method for controlling the amount of gene product, and agent for controlling the amount of gene product
03/04/2009EP2030985A1 Transporter genes OATP-B, C, D, and E
03/04/2009EP2030017A1 Method and kit for the detection of heparin-dependent antibodies and the diagnosis of immune or autoimmune pathologies potentiated by heparin such as heparin-induced thrombocytopenia
03/04/2009EP2030016A2 Methods and compositions for modulating hepsin activation of urokinase-type plasminogen activator
03/04/2009EP2030014A1 IN VITRO ASSAY BASED ON cAMP LEVELS MODULATED BY Gi-COUPLED RECEPTORS
03/04/2009EP2029783A2 Biological fixative and method of using the biological fixative
03/04/2009EP2029782A2 Recombinase polymerase amplification
03/04/2009EP2029781A2 Biochemical analysis of partitioned cells
03/04/2009EP2029780A2 Controlled initiation of primer extension
03/04/2009EP2029779A2 Use of highly parallel snp genotyping for fetal diagnosis
03/04/2009EP2029778A2 Diagnosis of fetal abnormalities using polymorphisms including short tandem repeats
03/04/2009EP2029777A2 Methods and compositions for the extraction and amplification of nucleic acid from a sample
03/04/2009EP2029776A2 Methods and compositions for assessment of pulmonary function and disorders
03/04/2009EP2029773A1 Methods and kits for linking polymorphic sequences to expanded repeat mutations
03/04/2009EP2029772A2 Microelectronic sensor device for dna detection
03/04/2009EP2029771A1 Diagnostic method for myopathy
03/04/2009EP2029770A2 A nucleic acid - polymer particle for and method of tracing movement of a liquid
03/04/2009EP2029769A1 Methods for diagnosing and treating graft rejection and inflammatory conditiions
03/04/2009EP2029768A2 Method of determining enzymatic activity in biological media
03/04/2009EP2029767A1 Devices and methods for reducing matrix effects
03/04/2009EP2029766A1 Pulsing of bile compartments in sandwich-cultured hepatocytes
03/04/2009EP2029765A2 Capillary flow control in a flow channel
03/04/2009EP2029747A1 Detection and use of antiviral resistance mutations
03/04/2009EP2029745A1 Diagnostic methods and markers
03/04/2009EP2029013A2 Nanoelectronic breath analyzer and asthma monitor
03/04/2009EP2028925A1 Totv-resistant plants
03/04/2009EP1934336A4 Thermostablization of dna polymerase by protein folding pathway from a hyperthermophile archaeon, pyrococcus furiosus
03/04/2009EP1838867A4 Apolipoprotein a-ii isoform as a biomarker for prostate cancer
03/04/2009EP1799858A4 Multiple mode multiplex reaction quenching method
03/04/2009EP1799856A4 Methods and compositions for detecting erythrovirus genotypes
1 ... 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 ... 3003