| Patents for C12P 21 - Preparation of peptides or proteins (112,499) |
|---|
| 06/29/2006 | US20060141576 Variants of corticotropin releasing hormone receptor type 1 and uses thereof |
| 06/29/2006 | US20060141575 Secreted proteins and nucleic acids encoding them |
| 06/29/2006 | US20060141574 Method for producing monoclonal antibodies |
| 06/29/2006 | US20060141573 Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same |
| 06/29/2006 | US20060141572 Recombinant light chains of botulinum neurotoxins and light chain fusion proteins for use in research and clinical therapy |
| 06/29/2006 | US20060141571 Method for promoting cell growth and increasing the production of the expressed target gene products |
| 06/29/2006 | US20060141570 Intein-mediated protein purification using in vivo expression of an aggregator protein |
| 06/29/2006 | US20060141569 Compositions and methods for the assay of G-protein coupled receptors and their ligands |
| 06/29/2006 | US20060141568 Modification of collagenous materials and medical treatment, diagnosis and monitoring of fibrotic conditions |
| 06/29/2006 | US20060141567 For selective modulation of leukocyte function, which is useful in a variety of inflammatory and autoimmune diseases, or in therapy of infections |
| 06/29/2006 | US20060141566 culturing host cells infected with the virus; separating the medium from the infected cells and using the separated virus containing medium for further purification, immunotherapy or vaccination of an animal |
| 06/29/2006 | US20060141565 Novel fibroblast growth factor and uses thereof |
| 06/29/2006 | US20060141564 Nucleic acids encoding duramycin |
| 06/29/2006 | US20060141563 Mutant protein and refolding method |
| 06/29/2006 | US20060141562 Mutant E. coli appa phytase enzymes and natural variants thereof, nucleic acids encoding such phytase enzymes, vectors and host cells incorporating same and methods of making and using same |
| 06/29/2006 | US20060141561 Apo-2 ligand/trail variants and uses thereof |
| 06/29/2006 | US20060141560 Estrogen receptor genes and utilization thereof |
| 06/29/2006 | US20060141559 Extract from cultured mammalian cell, process for preparation thereof and method of cell-free protein synthesis using the extract |
| 06/29/2006 | US20060141558 Bioproduction of astaxanthin using mutant carotenoid ketolase and carotenoid hydroxylase genes |
| 06/29/2006 | US20060141540 Direct selection of cells by secretion product |
| 06/29/2006 | US20060141535 Hyaluronan receptor for endocytosis |
| 06/29/2006 | US20060141524 Novel kinases and uses thereof |
| 06/29/2006 | US20060141522 Screening methods for identifying agonists and antagonists of hereulin -like factor (HLF) activity; diagnostic methods for detecting disorders of the regulation of cell growth and therapeutic methods for treating disorders of the regulation |
| 06/29/2006 | US20060141517 Protein having PDZ domain sequence |
| 06/29/2006 | US20060141515 Polynucleotides encoding plant cysteine proteases |
| 06/29/2006 | US20060141514 Thermus brockianus nucleic acid polymerases |
| 06/29/2006 | US20060141505 Chimeric fusion molecule for analyte detection and quantitation |
| 06/29/2006 | US20060141479 Diagnosis, psoriasis, rheumatoid arthritis, emphysema, asthma, diabetes, autoimmune thyroiditis, inflammatory bowel diseases, including Crohn's disease and ulcerative colitis, different types of dermatitis including allergic dermatitis, contact dermatitis, actinic keratosis, wound healing, cancer |
| 06/29/2006 | US20060141476 Growth arrest homeobox gene |
| 06/29/2006 | US20060141468 Novel notch-like polypeptides |
| 06/29/2006 | US20060141457 Nucleotide sequence encoding an acyltransferase polypeptide comprising membrane-spanning region; immobilization, freeze drying; contacting vegetable oil with polypeptide wherein fatty acids are transferred from phospholipid to an acceptor molecule; ester interchange; lecithin is converted to lysolecithin |
| 06/29/2006 | US20060141453 Prokineticin polypeptides, related compositions and methods |
| 06/29/2006 | US20060141451 Guinea pig proteinase-activated receptor 4 and its activating peptide |
| 06/29/2006 | US20060140979 Antigenic polypeptides |
| 06/29/2006 | US20060140972 Staphylococcus saprophyticus nucleic acids and polypeptides |
| 06/29/2006 | US20060140969 Hypoallergenic polypeptides based on fish parvalbumin |
| 06/29/2006 | US20060140967 Immunotherapy; detecting CD8 expressing T cells; biodrugs generate an immune response to breast cancer and prostate cancer cells that express TARP (T cell receptor gamma Alternate Reading Frame Protein); vaccines |
| 06/29/2006 | US20060140964 Human igm antibody lysing activated lymphocytes under mediation by homologous complement |
| 06/29/2006 | US20060140961 Compositions and methods for the diagnosis and treatment of tumor |
| 06/29/2006 | US20060140959 Old-35, a gene associated with senescence and terminal cell differentiation, and uses thereof |
| 06/29/2006 | US20060140958 Tumor antigen (TAG); labeled nucleotide sequence; gives rise to antigenic peptides which bind to major histocompatibility complex and recognized by cytotoxic lymphocytes; diagnosis and treatment of cancer |
| 06/29/2006 | US20060140954 Novel human protein kinases and protein kinase-like enzymes |
| 06/29/2006 | US20060140945 Nephropathy-associated gene |
| 06/29/2006 | US20060140944 Novel polypeptides involved in immune response |
| 06/29/2006 | US20060140942 Human G-protein coupled receptor (HETGQ23) |
| 06/29/2006 | US20060140941 Growth differentiation factor-3 |
| 06/29/2006 | US20060140937 B7-related nucleic acids and polypeptides useful for immunomodulation |
| 06/29/2006 | US20060140931 Bispecific molecule comprising an anti-cr1 antibody cross-linked to an antigen-binding antibody fragment |
| 06/29/2006 | US20060140929 reduced immunogenic potential; consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE |
| 06/29/2006 | US20060140920 Adenoviral vectors encoding an antibody fused to a CD4 extracellular domain |
| 06/29/2006 | US20060140905 Chemokine beta-7 variants |
| 06/29/2006 | DE10335584B4 Verfahren zur Herstellung zyklischer Moleküle A process for preparing cyclic molecules |
| 06/29/2006 | CA2594053A1 Vacuole targeting peptide and nucleic acid |
| 06/29/2006 | CA2593922A1 Recombinant production of serum albumin |
| 06/29/2006 | CA2591813A1 Anti-il-12 antibodies, epitopes, compositions, methods and uses |
| 06/29/2006 | CA2591781A1 Method for biotransformation of the clyclosporin compound isa247 |
| 06/29/2006 | CA2591745A1 Polypeptides having glucoamylase activity and polynucleotides encoding same |
| 06/29/2006 | CA2591665A1 Binding molecules capable of neutralizing west nile virus and uses thereof |
| 06/29/2006 | CA2590429A1 Compositions of aminoacyl-trna synthetase and uses thereof |
| 06/29/2006 | CA2589940A1 Process to improve activity of mannoprotein as wine stabiliser |
| 06/29/2006 | CA2589901A1 New mannoprotein with full solubility in wine and its application in the stabilisation of wine |
| 06/28/2006 | EP1674567A1 METHOD OF CLEAVING POLYPEPTIDE BY USING OmpT PROTEASE MUTANT |
| 06/28/2006 | EP1674564A1 Antibody against nox1 polypeptide, method of diagnosing cancer with the use of nox1 gene and method of screening cancer growth inhibitor |
| 06/28/2006 | EP1674480A1 Antibody recognizing tgf-beta activation controlling region section |
| 06/28/2006 | EP1674111A1 Anti-glypican 3 antibody |
| 06/28/2006 | EP1673464A2 Conjugation of peptides |
| 06/28/2006 | EP1673457A2 Novel fungal proteins and nucleic acids encoding same |
| 06/28/2006 | EP1673452A1 Method for large-scale production of a polypeptide in eukaryote cells and a culture vessel suitable therefor |
| 06/28/2006 | EP1673436A2 Nucleic acid molecules encoding novel human low-voltage activated calcium channel proteins, designated - alpha 1i-1 and alpha 1i-2, encoded proteins and methods of use thereof |
| 06/28/2006 | EP1673387A1 Il-21 derivatives |
| 06/28/2006 | EP1329460B1 Method of monomerizing human serum albumin polymers |
| 06/28/2006 | EP1272653B1 Methods for ansamitocin production |
| 06/28/2006 | EP1268783B1 Antiangiogene Eigenschaften von Matin und Fragmenten oder Varianten davon |
| 06/28/2006 | EP1261641B1 Diagnostic method using expression of mn/ca9 protein in agus pap smears |
| 06/28/2006 | EP1212451B1 Cyclic gmp dependent protein kinase as a chemotherapeutic target for antiprotozoal agents |
| 06/28/2006 | EP1157034B1 Process for production of diphtheria toxin |
| 06/28/2006 | EP1142905B1 Novel depsipeptide compound |
| 06/28/2006 | EP1062237B1 Ribonucleotide polypeptides containing metal |
| 06/28/2006 | EP1060251B1 Phosphodiesterase 10 |
| 06/28/2006 | EP0990041B1 Regulation of transcription in mammalian cells and viral replication by a tetracyclin repressor |
| 06/28/2006 | EP0970119B9 Synaptic activation protein compositions and method |
| 06/28/2006 | EP0935604B1 Magnetically activated cell sorting for production of proteins |
| 06/28/2006 | EP0897426B1 Matrix metalloprotease |
| 06/28/2006 | EP0882799B1 Anti-human vegf receptor flt-1 monoclonal antibody |
| 06/28/2006 | EP0832227B9 Method for prolonging the expression of a gene of interest using soluble ctla4 molecules |
| 06/28/2006 | EP0712414B1 Recombinant vector containing a lipoprotein gene sequence for expressing nucleotide sequences |
| 06/28/2006 | CN1795388A Diagnostic kit for liver cirrhosis comprising an antibody specific for human protooncogenic protein |
| 06/28/2006 | CN1795268A Method for manufacturing antigen-specific antibody-producing hybridomas employing a single antigen-specific b lymphocyte and method for manufacturing monoclonal antibody |
| 06/28/2006 | CN1795005A Medicine health-care usage of globefish I collagen extration and preparing process thereof |
| 06/28/2006 | CN1793380A Process and application for producing fermant protein peptide |
| 06/28/2006 | CN1793375A Yeast expressing system of recombined human nerve growth factor and process for preparing recombined human nerve grouth factor |
| 06/28/2006 | CN1793324A Process for modifying human interferon-bata by yeast expressing, producing and glycosylazing |
| 06/28/2006 | CN1793177A Recombined collagen and synthesizing and expressing purifying process thereof |
| 06/28/2006 | CN1793172A Non-inducing expressing gene engineering strain and structural process and application thereof |
| 06/28/2006 | CN1793169A Sea snail toxin variant polypeptide compound, its preparation process and application thereof |
| 06/28/2006 | CN1261581C Novel constructs for controlled expression of recombinant proteins in prokaryotic cells |
| 06/28/2006 | CN1261579C Hybrid proteins which form heterodimers |
| 06/28/2006 | CN1261571C Microbial swollenin protein, DNA sequences encoding |
| 06/28/2006 | CN1261455C Recombinant humanized anti-hepatitis B surface antigen (HBsAg) Fab antibody and its preparation method |
| 06/28/2006 | CN1261453C Platelet-derived growth factor D, DNA coding and uses thereof |