| Patents for C12N 9 - Enzymes, e.g. ligases (6.); Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating, or purifying enzymes (141,535) |
|---|
| 06/29/2006 | US20060140929 reduced immunogenic potential; consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE |
| 06/29/2006 | US20060140928 Use of heparinases to decrease inflammatory response |
| 06/29/2006 | US20060140927 Cytochrome P450 enzyme complexes and methods of treatment using the same |
| 06/29/2006 | US20060140917 Compositions and methods for selective dissolution of nascent intravascular blood clots |
| 06/29/2006 | DE10333144B4 Verfahren zur biotechnologischen Herstellung von Citronensäure mit einer genetisch veränderten Hefe Yarrowia lipolytica Process for the biotechnological production of citric acid with a genetically modified yeast Yarrowia lipolytica |
| 06/29/2006 | CA2606672A1 A novel polynucleotide involved in heritable parkinson's disease |
| 06/29/2006 | CA2593920A1 Alpha-amylase variants |
| 06/29/2006 | CA2592249A1 Binding proteins specific for human matriptase |
| 06/29/2006 | CA2592153A1 Resistance genes |
| 06/29/2006 | CA2592138A1 Compositions and methods for expression and purification of fatty acid amide hydrolase |
| 06/29/2006 | CA2592104A1 Enzymes for starch processing |
| 06/29/2006 | CA2592083A1 Hybrid enzymes consisting of an endo-amylase first amino acid sequence and a carbohydrate -binding module as second amino acid sequence |
| 06/29/2006 | CA2591745A1 Polypeptides having glucoamylase activity and polynucleotides encoding same |
| 06/29/2006 | CA2590497A1 Nucleic acid molecules encoding kcs-like polypeptides and methods of use |
| 06/29/2006 | CA2590429A1 Compositions of aminoacyl-trna synthetase and uses thereof |
| 06/29/2006 | CA2588758A1 Genetically engineered clostridial genes, proteins encoded by the engineered genes, and uses thereof |
| 06/28/2006 | EP1674578A1 Process for producing scyllo-inositol |
| 06/28/2006 | EP1674576A1 Recombinant allergen with reduced enzymatic activity |
| 06/28/2006 | EP1674569A1 Support having enzyme immobilized thereon, print, reagent kit, process for producing the support, method of preserving enzyme and method of revitalizing enzyme |
| 06/28/2006 | EP1674567A1 METHOD OF CLEAVING POLYPEPTIDE BY USING OmpT PROTEASE MUTANT |
| 06/28/2006 | EP1674565A2 Method for enhancing enzyme activity at elevated temperature |
| 06/28/2006 | EP1674564A1 Antibody against nox1 polypeptide, method of diagnosing cancer with the use of nox1 gene and method of screening cancer growth inhibitor |
| 06/28/2006 | EP1674474A1 Cyclic maltosyl maltose, cyclic maltosyl maltose synthase, method of producing the same and use thereof |
| 06/28/2006 | EP1673630A2 Mn/ca ix and cancer prognosis |
| 06/28/2006 | EP1673625A2 Generation of stabilized proteins by combinatorial consensus mutagenesis |
| 06/28/2006 | EP1673468A2 Methods for identifying compounds for inhibiting fever |
| 06/28/2006 | EP1673459A2 Luciferase biosensor |
| 06/28/2006 | EP1673457A2 Novel fungal proteins and nucleic acids encoding same |
| 06/28/2006 | EP1673454A1 Aqueous enzyme delivery system |
| 06/28/2006 | EP1673453A2 Hybrid molecules having factor vii/viia activity |
| 06/28/2006 | EP1673452A1 Method for large-scale production of a polypeptide in eukaryote cells and a culture vessel suitable therefor |
| 06/28/2006 | EP1673451A1 Protease variants |
| 06/28/2006 | EP1673450A1 Vitamin k epoxide recycling polypeptide vkorc1, a therapeutic target of coumarin and their derivatives |
| 06/28/2006 | EP1673437A2 Compositions and methods for synthesizing, purifying and detecting biomolecules |
| 06/28/2006 | EP1673099A1 Compositions and methods for inhibiting cell senescence and hyperproliferative disorders |
| 06/28/2006 | EP1383897B1 Self-containing lactococcus strain |
| 06/28/2006 | EP1332221B1 Enzyme catalysis in the presence of ionic liquids |
| 06/28/2006 | EP1212451B1 Cyclic gmp dependent protein kinase as a chemotherapeutic target for antiprotozoal agents |
| 06/28/2006 | EP1212429B1 Luciferase expression cassettes and methods of use |
| 06/28/2006 | EP1105515B1 Alpha 2,8/2,9 polysialyltransferase |
| 06/28/2006 | EP1060251B1 Phosphodiesterase 10 |
| 06/28/2006 | EP1045632B1 A starchless Pisum sativum plant with elevated levels of sucrose |
| 06/28/2006 | EP0897426B1 Matrix metalloprotease |
| 06/28/2006 | EP0727490B1 Human-origin prostacyclin synthase |
| 06/28/2006 | EP0693129B1 Method of inhibiting the transcription of genes |
| 06/28/2006 | CN1795270A DNA coding for protein having d-lactic acid dehydrogenase activity and use thereof |
| 06/28/2006 | CN1795264A Process for producing glucose dehydrogenase |
| 06/28/2006 | CN1795209A Cleavage of fusion proteins using granzyme b protease |
| 06/28/2006 | CN1794920A Method of improving taste and/or flavour of foods and beverages |
| 06/28/2006 | CN1793371A APDHI sequence of DNA unwindase gene of kender and its clone and applciation thereof |
| 06/28/2006 | CN1793368A Anti-arsenic genome in linear plasmid of streptomycete |
| 06/28/2006 | CN1793352A Process for increasing stability of elastase of lichen spore bacillus ZJUEL31410 |
| 06/28/2006 | CN1793351A Hydrolase with substrate selective memory and preparation process thereof |
| 06/28/2006 | CN1793350A Process for preparing pig thrombiase |
| 06/28/2006 | CN1793349A Process for producing bata-mannanase fermented by pseudo honey agaric and application thereof |
| 06/28/2006 | CN1793348A Acid trehalosease and preparation process thereof |
| 06/28/2006 | CN1793347A Compound enzyme of making wine with uncooked material and process for making wine by same compound enzyme |
| 06/28/2006 | CN1793346A Corn SOD molecular modifying agent and modifying process thereof |
| 06/28/2006 | CN1793345A Metallic chelate affinity medium and process for chromatographic purifying corn SOD thereof |
| 06/28/2006 | CN1793329A Prolan enzyme bacterial and preparation process |
| 06/28/2006 | CN1793328A Nie's brevibacterium new strain and process for preparing enzyme by it |
| 06/28/2006 | CN1793321A Microorganism of producing D-pantothenic acid enternal ester hydrolase and process for preparing D-pantothenic acid thereof |
| 06/28/2006 | CN1792241A Hickory chick seasoning, and its prodn. method |
| 06/28/2006 | CN1261582C Enzymatic acylation method |
| 06/28/2006 | CN1261581C Novel constructs for controlled expression of recombinant proteins in prokaryotic cells |
| 06/28/2006 | CN1261578C Meishen kidney strengthening Chinese medicinal preparation and its preparation method |
| 06/28/2006 | CN1261577C Method for modifying plant morphology, biochemistry and physiology |
| 06/28/2006 | CN1261571C Microbial swollenin protein, DNA sequences encoding |
| 06/28/2006 | CN1261568C Method of maintaining or improving a nitrile hydratase activity |
| 06/28/2006 | CN1261567C Thermostable glucoamylase |
| 06/28/2006 | CN1261566C Method for preparing non-receptor type tyrosine protein kinase Syk |
| 06/28/2006 | CN1261565C Method for distilling superoxide dismutase from corn |
| 06/28/2006 | CN1261453C Platelet-derived growth factor D, DNA coding and uses thereof |
| 06/28/2006 | CN1261451C Silicatein-mediated synthesis of amorphous silicates and siloxanes and use thereof |
| 06/27/2006 | US7067726 Transgenic corn which express ligninolytic enzymes for use in papermaking, waste treatment, bioremediation and pollution control |
| 06/27/2006 | US7067722 Nucleic acid sequences and methods of use for the production of plants with modified polyunsaturated fatty acids |
| 06/27/2006 | US7067720 Inositol polyphosphate kinase genes and uses thereof |
| 06/27/2006 | US7067718 Method of producing diacylglycerol and gene for inactivating function of gene which encodes diacylglycerol acyltransferase |
| 06/27/2006 | US7067712 Transgenic animal; animal models; gene expression; skin disorders |
| 06/27/2006 | US7067647 Nucleotide sequences coding enzymatic polypeptide for use in generating disease resistant plants |
| 06/27/2006 | US7067644 Expression vector for use as cloning tool in genetic engineering |
| 06/27/2006 | US7067643 Nucleases and exonucleases; radiolabelling, fluorescence |
| 06/27/2006 | US7067631 Fused DNA sequence, fused protein expressed from said fused DNA sequence and method for expressing said fused protein |
| 06/27/2006 | US7067630 Transmembrane serine protease overexpressed in ovarian carcinoma and uses thereof |
| 06/27/2006 | US7067496 Transplanting into dermis, least one hair follicle that has been modified ex vivo to contain nucleic acid molecule to introduce nucleic acid molecule into mammal |
| 06/27/2006 | US7067486 Acetylcholinesterase-derived peptides and uses thereof |
| 06/27/2006 | US7067484 AL-1 neurotrophic factor treatments |
| 06/27/2006 | US7067302 DNA and amino acid sequence of a tyrosine ammonia lyase enzyme from the bacterium Rhodobacter sphaeroides |
| 06/27/2006 | US7067300 Comprises nucleotide sequences coding 1,3-propanediol oxidoreductase (DHAT) for conversion of 3-hydroxypropionaldehyde to 1,3 propanediol |
| 06/27/2006 | US7067298 Compositions and methods of using a synthetic Dnase I |
| 06/27/2006 | US7067297 Mannosyltransferase polypeptides and polynucleotides encoding them and methods for making and using them |
| 06/27/2006 | US7067296 Enzymatic polypeptide for use in the treatment of pain, inflammation, arthritis, cancer and alzheimer's disease |
| 06/27/2006 | US7067295 Glucose dehydrogenase |
| 06/27/2006 | US7067294 Catalytic surfaces for active protection from toxins |
| 06/27/2006 | US7067288 Nucleotide sequences which code for the mdhA gene |
| 06/27/2006 | US7067286 Cystobacterineae host cells containing heterologous PKS genes for the synthesis of polykedtides |
| 06/27/2006 | US7067285 Desaturase genes and uses thereof |
| 06/27/2006 | US7067283 via cells extracted from adenovirus-transferred kedney cell liver |
| 06/27/2006 | US7067280 Human cartilage glycoprotein |
| 06/27/2006 | US7067275 Bioanalytical measuring method for determining catalases and peroxidases, as well as conjugates, substrates, activators and inhibitors thereof |