Patents
Sitemap › C12 - Biochemistry; Beer; Spirits; Wine; Vinegar; Microbiology; Enzymology; Mutation or genetic engineering › C12N - Micro-organisms or enzymes; Compositions thereof; Propagating, preserving, or maintaining micro-organisms; Mutation or genetic engineering; Culture media › C12N 9 - Enzymes, e.g. ligases (6.); Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating, or purifying enzymes
Patents for C12N 9 - Enzymes, e.g. ligases (6.); Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating, or purifying enzymes (141,535)
03/2009
03/11/2009CN101381713A Preparation technology of high temperature resistant feeding cellulase
03/11/2009CN101381712A Amylase variants
03/11/2009CN101381711A Method for producing inulase by solid fermentation
03/11/2009CN101381710A Technique for recovering immobilized lipase in biodiesel preparation using centrifugation technology
03/11/2009CN101381709A Phytase and preparation method thereof
03/11/2009CN101381708A Fibrized cellulomonas cartae, hydrolase and application thereof in taxane conversion aspect
03/11/2009CN101381707A Separation and purification method of haloperoxidase
03/11/2009CN101381698A Recombinant corynebacterium crenatum for over expression of N-acetylglutamate kinase and application thereof
03/11/2009CN101381683A Trichoderma SC9 and preparation method of cold-resistant xylanase using thereof
03/11/2009CN101381133A Method for treating electrophoretic paint waste water
03/11/2009CN101380551A Preparation method of nylon affinity membrane and use thereof
03/11/2009CN101380319A Inhibitors of glycogen synthase kinase-3 (gsk-3) for treating glaucoma
03/11/2009CN100467609C Method for saccharification of lignocellulose by ultrasonic synergistic catalysis of modified cellulose
03/11/2009CN100467603C DNA sequences coding for the human proteins TX and TY related to the interleukin-IBeta converting enzyme
03/11/2009CN100467602C Esterases, DNA encoding therefor and vectors and host cells incorporating same
03/11/2009CN100467601C PIM-3 kinase as a target for type 2 diabetes mellitus
03/11/2009CN100467593C SQS gene
03/11/2009CN100467592C Preparation of highland barley SOD
03/11/2009CN100467586C Aspergillus niger WZ001 capable of producing naringinase and cirmtimase simultaneously and its application
03/10/2009US7501556 Genetically engineered plant comprising daidzein and/or derivatives; does not naturally produce isoflavones and is active in both flavonol and anthocyanin biosynthesis; comprises nucleotide sequences encoding a chalcone reductase and isoflavone synthase; foods; cancer, cardiovascular disorders
03/10/2009US7501501 MHC-Class II restricted melanoma antigens and their use in therapeutic methods
03/10/2009US7501273 Peptidylarginine deiminase 6
03/10/2009US7501272 Comprise genetically engineered endoglucanse III with improved stability for use in treatment of textiles, wood pulp, animal feeds and reduction of biomass to glucose
03/10/2009US7501271 Anthocyanin 5-O-glucosyltransferases, an enzyme that transfers a glycoside to the 5 position of a flavonoid, isolated from Perilla fruescens, Verbena hybrida, Torenia hybrida, and Petunia hybrida; artificially coloring plants and flowers
03/10/2009US7501270 Oxygen-resistant hydrogenases and methods for designing and making same
03/10/2009US7501268 Methods of producing prenyl alcohols
03/10/2009US7501267 Gene sequence of L-rhamnose isomerase having new catalytic function and use thereof
03/10/2009US7501266 Using multiplexed DNA binding and imaging analysis to identify nucleotide sequence modifications which are associated and diagnostic of cystic fibrosis; genetic screening for mutations and polymorphisms using an array of probe pairs in Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) gene
03/10/2009US7501265 Method for producing and cleaving a fusion proteins with an n-terminal chymosin pro-peptide
03/10/2009US7501259 hydrolase enzyme immobilized within polyelectrolyte (polyethyleneimine, polyacrylic acid , polystyrene sulfonate, polydiallyldimethylammonium chloride), depositing endcapping agent ( 1,2-dihydroxypropyl methacrylate, 1,2-dihydroxypropyl 4-vinylbenzyl ether), polymerizing end capper; chemical resistance
03/10/2009US7501246 Gene for coding thermostable L-arabinose isomerase and method for producing the same
03/10/2009US7501244 Determining prognosis of colon or breast cancer by measuring TTK expression
03/10/2009US7501243 Identification of cancerous cells and identifying antitumor drugs by detection of expression levels of tyrosine threonine kinase; inhibiting tumor growth (especially breast and colon cancer)by inhibiting activity of TTK
03/10/2009US7501242 Detection of colon or breast cancer by measuring TTK polynucleotide expression
03/10/2009US7501237 Detection, classification and evaluation of preferential nucleotide sequences; obtain nucleotide sequences, incubate with polymerases and primers, amplify, analyze amplified nucleotide sequences
03/10/2009US7501118 Human gene relating to respiratory diseases and obesity
03/10/2009US7501117 Proteolytic blood coagulation factor for treatment and prevention of preclampsia and thrombotic disorders
03/10/2009US7501116 Placental alkaline phosphatase to control diabetes
03/10/2009CA2329255C Method of producing thy a-strains of vibrio cholerae, such strains and their use
03/10/2009CA2258270C Beverage antioxidant system
03/10/2009CA2197677C A method of selectively destroying neoplastic cells
03/05/2009WO2009029739A2 Methods involving genes encoding nucleoside diphosphatase kinase (ndk) polypeptides and homologs thereof for modifying the plant's root architecture
03/05/2009WO2009029665A2 Improved methods for protein production
03/05/2009WO2009028338A1 Novel oxidase gene and method of producing 3-indole-pyruvic acid using the gene
03/05/2009WO2009028294A1 Mutant lipase and use thereof
03/05/2009WO2009028253A1 Peptide production method
03/05/2009WO2009027978A1 NUCLEIC ACID SEQUENCES COMPRISING NF-ϰB BINDING SITE WITHIN O(6)-METHYLGUANINE-DNA-METHYLTRANSFERASE (MGMT) PROMOTER REGION AND USES THEREOF FOR THE TREATMENT OF CANCER AND IMMUNE-RELATED DISORDERS
03/05/2009WO2009027572A1 Use of active recombinant chymosin
03/05/2009WO2009027478A2 A method of removing preservatives from a liquid pharmaceutical preparation
03/05/2009WO2009027471A1 Methods for increasing protein titers
03/05/2009WO2009027334A1 Reduction of dimer content in factor vii polypeptide compositions by heat treatment
03/05/2009WO2009026722A1 Enzymatic hydrolysis of lignocellulosic feedstocks using accessory enzymes
03/05/2009WO2009026716A1 Method for cellulase production
03/05/2009WO2009010251A3 Mutant dna polymerases and related methods
03/05/2009WO2009005564A3 Cellulose- and hemicellulose-degradation enzyme -encoding nucleotide sequences with refined translational kinetics and methods of making same
03/05/2009WO2008153676A3 Pentose phosphate pathway and fermentation enzyme-encoding nucleotide sequences with refined translational kinetics and methods of making same
03/05/2009WO2008152523A9 Meganuclease variants cleaving a dna target sequence from the mouse rosa26 locus and uses thereof
03/05/2009WO2008148845A3 Method of preparing a dough-based product
03/05/2009WO2008122435A3 Use gene variants of the human meis1, btbd9, map2k5, lbxcor1, ptprd or a2bp1 gene for diagnostic and therapeutic approaches to restless legs syndrome (rls)
03/05/2009WO2008107560A3 Method and equipment for producing fruit sugar syrups having high fructose content
03/05/2009WO2008066752A3 Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including igf-ir
03/05/2009WO2005003311A9 Enzymes for starch processing
03/05/2009US20090064377 Method and means for targeted nucleotide exchange
03/05/2009US20090062286 Crystal Structure of SMYD3 Protein
03/05/2009US20090062282 Substituted Amino-Pyrimidones and Uses Thereof
03/05/2009US20090062180 Polypeptide biodrugs with given amino acid sequence which includes phosphorylated serine or threonine conjugated to a hydrophobic moiety such as a fatty acid; treating disorders such as Type II Diabetes, neurodegenerative diseases and psychological disorders
03/05/2009US20090062139 Phytases, nucleic acids encoding them and methods for making and using them
03/05/2009US20090062137 Methods For Identification, and Compounds Useful For The Treatment Of Degenerative & Inflammatory Diseases
03/05/2009US20090061510 Vectors, eukaryotic cells
03/05/2009US20090061502 Ethanol productivities of saccharomyces cerevisiae strains in fermentation of dilute-acid hydrolyzates depend on their furan reduction capacities
03/05/2009US20090061500 Novel protein-deamidating enzyme, microorganism producing the same, gene encoding the same, production process therefor, and use thereof
03/05/2009US20090061498 Polyhydroxyalkanoate-containing structure and manufacturing method thereof
03/05/2009US20090061486 Method for cellulase production
03/05/2009US20090061484 Enzymatic hydrolysis of lignocellulosic feedstocks using accessory enzymes
03/05/2009US20090061483 Acid fungal proteases
03/05/2009US20090061482 Nucleotide sequences of coryneform bacteria coded for proteins participating in l-serine metabolism and method for microbial production of l-serine
03/05/2009US20090061481 Highly-efficient hyperthermophilic dna ligase
03/05/2009US20090061420 Mutational profiles in hiv-1 protease correlated with phenotypic drug resistance
03/05/2009US20090060933 Proteases producing an altered immunogenic response and methods of making and using the same
03/05/2009US20090060900 Methods for Screening Compounds That Modulate Lipid Metabolism
03/05/2009US20090060895 Compositions and Methods of Using Chondroitinase ABCI Mutants
03/05/2009US20090060866 Phosphadiazine hcv polymerase inhibitors i and ii
03/05/2009US20090060862 PEGylation by the Dock and Lock (DNL) Technique
03/05/2009DE102007058407A1 Antikörper gegen die Epitope GRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM oder IFNQKIVNGWQVEEADDWLRYGNPWEKARP oder GLGDVAWVRKSFNRHLHFTLVKDRNVATPRDYFFA oder DSMATLGLAAYGYGIRYEFG Antibodies against epitopes GRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM or IFNQKIVNGWQVEEADDWLRYGNPWEKARP or GLGDVAWVRKSFNRHLHFTLVKDRNVATPRDYFFA or DSMATLGLAAYGYGIRYEFG
03/05/2009CA2697791A1 Enzymatic hydrolysis of lignocellulosic feedstocks using accessory enzymes
03/05/2009CA2697248A1 Reduction of dimer content in factor vii polypeptide compositions by heat treatment
03/05/2009CA2697090A1 Method for cellulase production
03/05/2009CA2696809A1 Method of increasing protein titres
03/05/2009CA2695646A1 Plants with altered root architecture, related constructs and methods involving genes encoding nucleoside diphosphatase kinase (ndk) polypeptides and homologs thereof
03/04/2009EP2031390A1 Stabilizing agent and blocking agent
03/04/2009EP2031066A1 Mutant and gene encoding the same
03/04/2009EP2031064A1 Method for increasing protein titres
03/04/2009EP2031055A1 DNA molecule with insulator activity against chromosomal position effects in gene transfer processes in animal cells
03/04/2009EP2031054A1 Fusion protein, gene related to fusion protein, vector, transformants, and anti-inflammatory medicinal composition
03/04/2009EP2029762A1 Enzyme compositions for the improved enzymatic hydrolysis of cellulose and methods of using same
03/04/2009EP2029761A1 Enzyme compositions and methods for the improved enzymatic hydrolysis of cellulose
03/04/2009EP2029740A1 Use of polysaccharides for promotion of enzymatic activity
03/04/2009EP2029738A2 Factor ix analogues having prolonged in vivo half life
03/04/2009EP2029737A2 Cleaning and/or treatment compositions comprising mutant alpha-amylases
03/04/2009EP2029736A2 Catalytically inactive proteins and method for recovery of enzymes from plant-derived materials
1 ... 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 ... 1416