Patents for C07K 16 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies (149,320) |
---|
03/05/2009 | WO2009026723A1 Antigenic compositions and use of same in the targeted delivery of nucleic acids |
03/05/2009 | WO2009026692A1 An anti-cancer cytotoxic monoclonal antibody |
03/05/2009 | WO2009026660A1 Dendritic cell marker and uses thereof |
03/05/2009 | WO2009026638A1 Marine-animal derived therapeutic and diagnostic agents for hepatitis b |
03/05/2009 | WO2009026615A1 Group a streptococcus pharmaceutical compositions and methods thereof |
03/05/2009 | WO2009010539A3 Receptor for interleukin-6 (il-6) from macaca fascicularis |
03/05/2009 | WO2009010474A9 Antibody or fragment thereof recognizing avitagtm and uses thereof |
03/05/2009 | WO2008157263A3 Methods of delivery of molecules to cells using a ricin subunit and compositions relating to same |
03/05/2009 | WO2008156704A3 Antibody-mediated modulation of allergy |
03/05/2009 | WO2008153790A3 Methods of modulating inflammation and compositions therefore |
03/05/2009 | WO2008153705A3 Methods of treating, diagnosing and detecting fgf21-associated disorders |
03/05/2009 | WO2008147434A9 TREATMENT AND PREVENTION OF CHRONIC ASTHMA USING ANTAGONISTS OF INTEGRIN αVβ6 |
03/05/2009 | WO2008143697A3 Antibody with protein a selectivity |
03/05/2009 | WO2008140570A3 Antibody with protein a selectivity |
03/05/2009 | WO2008137881A3 Ehrlichia ewingii proteins, nucleic acids, and methods of their use |
03/05/2009 | WO2008133652A3 Binary epitope antibodies and b cell superantigen immune stimulants |
03/05/2009 | WO2008105886A3 HUMANIZED FCγRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
03/05/2009 | WO2008063776A3 Antibodies to lymphotoxin-alpha |
03/05/2009 | WO2008030505A8 Methods and compositions for the treatment of antibody mediated neuropathies |
03/05/2009 | WO2005094355A3 Methods for altering protein production rates |
03/05/2009 | WO2005014618A3 Bispecific antibodies for inducing apoptosis of tumor and diseased cells |
03/05/2009 | WO2003048376A9 Modulation of immune-cell related disorders using il-1hy2 |
03/05/2009 | US20090062514 Plant viral particles comprising a plurality of fusion proteins consisting of a plant viral coat protein, a peptide linker and a recombinant protein and use of such plant viral particles for protein purification |
03/05/2009 | US20090062194 Compositions and methods for the therapy and diagnosis of lung cancer |
03/05/2009 | US20090062188 Disease-Associated Protein |
03/05/2009 | US20090062133 Expression analysis of FKBP54 in the diagnosis and treatment of prostate cancer |
03/05/2009 | US20090061511 Gamma-1 and gamma-3 anti-human cd23 monoclonal antibodies and use thereof as therapeutics |
03/05/2009 | US20090061480 Nucleotide sequence encoding a modulator of nf-kb |
03/05/2009 | US20090061467 Methods and Compositions for Measuring Canine BNP and Uses Thereof |
03/05/2009 | US20090061459 Reagents for the detection of protein phosphorylation in carcinoma signaling pathways |
03/05/2009 | US20090061452 Polymorphisms in the human genes for OCT 1 and their use in diagnostic and therapeutic applications |
03/05/2009 | US20090061431 Method of prognosing and diagnosing hereditary spastic paraplegia, mutant nucleic acid molecules and polypeptides |
03/05/2009 | US20090060954 Recombinant BCG Vaccine |
03/05/2009 | US20090060949 Flu vaccines and methods of use thereof |
03/05/2009 | US20090060935 Amebiasis vaccine |
03/05/2009 | US20090060925 Rage Fusion Proteins and Methods of Use |
03/05/2009 | US20090060924 having high affinity and strong neutralizing properties; increasing bone mass, bone mineral density and bone strength and for the treatment of various disorders, e.g. osteoporosis |
03/05/2009 | US20090060921 Glycan-optimized anti-cd20 antibodies |
03/05/2009 | US20090060920 Desacyl ghrelin antibodies and therapeutic uses thereof |
03/05/2009 | US20090060919 BINDING MEMBERS FOR IgE MOLECULES |
03/05/2009 | US20090060916 Ligands that bind IL-4 and/or IL-13 |
03/05/2009 | US20090060915 Polypeptide, vaccine and use thereof |
03/05/2009 | US20090060914 Deimmunized monoclonal antibodies for protection against hiv exposure and treatment of hiv infection |
03/05/2009 | US20090060911 Enhancement of antibody-mediated immune responses |
03/05/2009 | US20090060910 Covalent diabodies and uses thereof |
03/05/2009 | US20090060909 Antibody antagonists of ve-cadherin without adverse effects on vascular permeability |
03/05/2009 | US20090060908 antibodies exhibit increased antibody-dependent cellular cytotoxicity activity; humanizing, chimera |
03/05/2009 | US20090060907 Antibody against secreted N-terminal peptide of GPC3 present in blood or C-terminal peptide of GPC3 |
03/05/2009 | US20090060900 Methods for Screening Compounds That Modulate Lipid Metabolism |
03/05/2009 | US20090060899 Composition of organic compounds |
03/05/2009 | US20090060865 Mammalian receptor proteins; related reagents and methods |
03/05/2009 | US20090060864 administering an antitumor agent containing a combination of an alpha v beta 3 angiogenisis antagonist and an anti-tumor immunotherapeutic agent, which is a fusion protein of a cytokine IL-2 and an Ig heavy chain that immunoreacts with a tumor associated antigen target; drug target |
03/05/2009 | US20090060862 PEGylation by the Dock and Lock (DNL) Technique |
03/05/2009 | DE102007058407A1 Antikörper gegen die Epitope GRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM oder IFNQKIVNGWQVEEADDWLRYGNPWEKARP oder GLGDVAWVRKSFNRHLHFTLVKDRNVATPRDYFFA oder DSMATLGLAAYGYGIRYEFG Antibodies against epitopes GRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM or IFNQKIVNGWQVEEADDWLRYGNPWEKARP or GLGDVAWVRKSFNRHLHFTLVKDRNVATPRDYFFA or DSMATLGLAAYGYGIRYEFG |
03/05/2009 | CA2715305A1 Methods and compositions for modulating t cells |
03/05/2009 | CA2715103A1 Monoclonal antibody which binds met in formalin-fixed and paraffin-embedded tissues and related methods |
03/05/2009 | CA2698146A1 Anti-epha2 antibody |
03/05/2009 | CA2697976A1 A process for producing a peptide hormone |
03/05/2009 | CA2697719A1 Needle-free delivery device for therapeutic proteins based on single antigen-binding domains such as nanobodies |
03/05/2009 | CA2697529A1 Receptor-targeting reagents |
03/05/2009 | CA2697480A1 Detection of bacteria belonging to the genus campylobacter by targeting cytolethal distending toxin |
03/05/2009 | CA2697448A1 Dendritic cell marker and uses thereof |
03/05/2009 | CA2696809A1 Method of increasing protein titres |
03/05/2009 | CA2687681A1 Antigen-binding proteins targeting s. aureus orf0657n |
03/05/2009 | CA2685714A1 Inducible mutagenesis of target genes |
03/04/2009 | EP2031076A1 Novel compositions and methods for cancer |
03/04/2009 | EP2031064A1 Method for increasing protein titres |
03/04/2009 | EP2031062A1 Dna encoding polypeptide capable of modulating muscle-specific tyrosine kinase activity |
03/04/2009 | EP2030016A2 Methods and compositions for modulating hepsin activation of urokinase-type plasminogen activator |
03/04/2009 | EP2029628A2 Antibodies selectively binding aggregated prion protein 106-126 and uses thereof |
03/04/2009 | EP2029627A2 Hepatocyte growth factor (hgf) binding proteins |
03/04/2009 | EP2029626A2 Immune-derived moieties reactive against lysophosphatidic acid |
03/04/2009 | EP2029625A2 Use of tgf-beta antagonists in treatment of parathyroid-related disorders |
03/04/2009 | EP2029624A1 Peptide associated with rheumatic fever (parf) and its use as a diagnostic marker |
03/04/2009 | EP2029621A2 Blood-brain barrier targeting antibodies |
03/04/2009 | EP2029620A1 Ob fold domains |
03/04/2009 | EP2029173A2 Fc riib-specific antibodies and methods of use thereof |
03/04/2009 | EP2029172A2 Anti-c35 antibodies for treating cancer |
03/04/2009 | EP2029171A1 Methods of modulating il-22 and il-17 |
03/04/2009 | EP2029163A2 Lyophilized formulations of anti-egfr antibodies |
03/04/2009 | EP1886140A4 Immunological assays and antibodies for anti-mullerian hormone |
03/04/2009 | EP1700120B1 Marker for neuromyelitis optica |
03/04/2009 | EP1519957B1 Use of hmgb1 in the treatment of tissue damage and/or to promote tissue repair |
03/04/2009 | EP1432738B1 Carbohydrate binding domain containing fusion proteins for delivery of therapeutic and other agents, and compositions containing them |
03/04/2009 | EP1418813A4 Methods, compositions and kits relating to chitinases and chitinase-like molecules and inflammatory disease |
03/04/2009 | EP1414494B1 Inhibitory antibodies of her3 activity |
03/04/2009 | EP1294876B1 Eg-vegf nucleic acids and polypeptides and methods of use |
03/04/2009 | EP1255845B1 Modified cytokines for use in cancer therapy |
03/04/2009 | EP1246917B1 Human stra6 polypeptides |
03/04/2009 | EP1181366B1 Mammalian receptor proteins; related reagents and methods |
03/04/2009 | EP1078006B1 Diagnosis and treatment of hepatic disorders |
03/04/2009 | EP1045861B1 Bispecific targeting moiety comprising an antibody to carcinoembryonic antigen (cea) and the ligand-binding region of the il13 receptor alpha subunit |
03/04/2009 | EP1021542B1 Apo-3 ligand |
03/04/2009 | EP1019085B1 Non-anaphylactic forms of allergens and their use |
03/04/2009 | EP0988054B1 Method and compositions for preventing and treating the systemic inflammatory response syndrome including sepsis |
03/04/2009 | CN101379192A Anti-Met monoclonal antibody, fragments and vectors thereof, for the treatment of tumors and corresponding products |
03/04/2009 | CN101379184A Novel oxidoreductases and uses thereof |
03/04/2009 | CN101379090A Antibodies to OX-2/CD200 and uses thereof |
03/04/2009 | CN101379089A Anti-ILT7 antibody |
03/04/2009 | CN101379088A Bispecific ligands with binding specificity to cell surface targets and methods of use therefor |