Patents for C07K 16 - Immunoglobulins, e.g. monoclonal or polyclonal antibodies (149,320) |
---|
09/17/2009 | WO2009113295A1 C2orf18 as target gene for cancer therapy and diagnosis |
09/17/2009 | WO2009113083A1 A monoclonal antibody and a method thereof |
09/17/2009 | WO2009113065A1 Immuno-modulating compositions for the treatment of immune-mediated disorders |
09/17/2009 | WO2009112670A2 Use of a protein or nitrated peptide sequence for implementing a diagnosis method |
09/17/2009 | WO2009112603A1 Fusion protein that directs vaccine antigens to antigen-presenting cells, and applications thereof |
09/17/2009 | WO2009112502A1 Agent for treating disease |
09/17/2009 | WO2009112245A1 Antibody against the csf-1 r |
09/17/2009 | WO2009111865A1 Reagents and methods for detecting influenza virus proteins |
09/17/2009 | WO2009111840A1 Enzymes and methods for degrading bipyridylium herbicides |
09/17/2009 | WO2009092806A3 Selective exosite inhibition of papp-a activity against igfbp-4 |
09/17/2009 | WO2009087173A3 Antibody designated barb3, barb3 related antibodies, and methods of making and using same |
09/17/2009 | WO2009077731A3 Prolactin fusion proteins |
09/17/2009 | WO2009055783A3 Anti-pcsk9 and methods for treating lipid and cholesterol disorders |
09/17/2009 | WO2009019531A3 Bioactive peptides and method of using same |
09/17/2009 | WO2008084106A9 Anti-kir antibodies, formulations, and uses thereof |
09/17/2009 | WO2005072129A9 Production of host cells containing mutiple integrating vectors by serial transduction |
09/17/2009 | WO2001085908A9 Clasp-1 transmembrane protein |
09/17/2009 | US20090235371 Diagnostic method |
09/17/2009 | US20090234106 Anti-activin a antibodies and uses thereof |
09/17/2009 | US20090234105 Construction of a Multivalent SCFV Through Alkyne-Azide 1,3-Dipolar Cycloaddition |
09/17/2009 | US20090234104 Modified Fc molecules |
09/17/2009 | US20090234103 Novel inhibitors of vascular endothelial growth factor activity, their uses and processes for their production |
09/17/2009 | US20090234102 Hepatitis c virus inhibitors |
09/17/2009 | US20090234033 Separating Agent for IgG Purification and Method for Purifying an IgG Monomer by Using It |
09/17/2009 | US20090233986 Methods and compositions for using sax2 |
09/17/2009 | US20090233982 Methyltransferases and Their Uses |
09/17/2009 | US20090233855 Compounds and methods for modulating activation of nf-kb |
09/17/2009 | US20090233850 CVN-12p1: a recombinant allosteric lectin antagonist of HIV-1 envelope gp120 interactions |
09/17/2009 | US20090233812 Target recognizing binding agents |
09/17/2009 | US20090233807 Assays that use the t1r1 receptor polypeptides to screen for t1r1-associated taste modulators |
09/17/2009 | US20090233380 Methods and Compositions of Conjugating Gold to Biological Molecules |
09/17/2009 | US20090233357 Targeted Delivery of Compounds Using Multimerization Technology |
09/17/2009 | US20090233317 Repressor of skeletal muscle differentiation, nucleic acids coding therefor and the use thereof in diagnosis and therapy |
09/17/2009 | US20090233316 Protein, An Antibody and Measurement of the Protein |
09/17/2009 | US20090233281 Diagnostic marker for allergy |
09/17/2009 | US20090233274 Drug development target protein and target gene, and method of screening |
09/17/2009 | US20090233267 Methylated Tat Polypeptides and Methods of Use Thereof |
09/17/2009 | US20090232936 Novel lipases and uses thereof |
09/17/2009 | US20090232854 Uses of bispecific antibody coated dendritic cells pulsed with antigens and gm-csf in immune regulation |
09/17/2009 | US20090232840 Vaccines against escherichia coli o157 infection |
09/17/2009 | US20090232839 Glycoprotein-100 peptide for use as tool in treatment and diagnosis of cancer and viral infection |
09/17/2009 | US20090232837 Anti tumoral immunogenic peptides and vaccine thereof |
09/17/2009 | US20090232833 Polyalkylene oxides having hindered ester-based biodegradable linkers |
09/17/2009 | US20090232830 Modified HIV-1 Envelope Proteins |
09/17/2009 | US20090232826 Antibody or a fragment thereof, having neutralizing activity against hiv but not against il2 |
09/17/2009 | US20090232825 Methods and Compositions For Modulating Immunity |
09/17/2009 | US20090232824 Bivm (basic, immunoglobulin-like variable motif-containing) gene, transcriptional products, and uses thereof |
09/17/2009 | US20090232823 Anti-tyrp1 antibodies |
09/17/2009 | US20090232822 Lung disease targets and uses thereof |
09/17/2009 | US20090232820 Neisseria meningitidis antigens and compositions |
09/17/2009 | US20090232818 Prognosis and Treatment of Breast Cancer |
09/17/2009 | US20090232817 Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof |
09/17/2009 | US20090232816 Il-1 eta dna and polypeptides |
09/17/2009 | US20090232815 Monoclonal antibody or antibody fragment which binds a pleiotrophin-binding fragment of human Anaplastic Lymphoma Kinase (ALK) and inhibits a pleiotrophin-mediated activity; prevents pleiotrophin-mediated neoplastic or mitogenic activity |
09/17/2009 | US20090232812 Muc1 extracellular domain and cancer treatment compositions and methods derived therefrom |
09/17/2009 | US20090232811 Bivalent, bispecific antibodies |
09/17/2009 | US20090232810 Immunoconjugates targeting cd138 and uses thereof |
09/17/2009 | US20090232809 Type 2 cytokine receptor and nucleic acids encoding same |
09/17/2009 | US20090232808 Molecules and chimeric molecules thereof |
09/17/2009 | US20090232805 Methods of inhibiting receptor tyrosine kinases with an extracellular antagonist and an intracellular antagonist |
09/17/2009 | US20090232804 Humanized antibodies specific for von willebrand factor |
09/17/2009 | US20090232803 Antibodies to human il-1beta |
09/17/2009 | US20090232801 Humanized Antibodies Which Bind To AB (1-42) Globulomer And Uses Thereof |
09/17/2009 | US20090232799 Antibodies that bind urokinase-type plasminogen activator and epitopes therefor |
09/17/2009 | US20090232798 Methods and compositions for treating herpes infections |
09/17/2009 | US20090232795 1b20 pcsk9 antagonists |
09/17/2009 | US20090232794 Modulators of neuronal regeneration |
09/17/2009 | US20090232773 Method for Distinguishing Mesenchymal Stem Cell Using Molecular Marker and Use Thereof |
09/17/2009 | US20090232736 Dual specificity antibodies and methods of making and using |
09/17/2009 | US20090232734 Anti-tissue factor antibodies and compositions |
09/17/2009 | US20090232732 PRO108 Antibody Compositions and Methods of Use and Use of PRO108 to Assess Cancer Risk |
09/17/2009 | CA2718878A1 Compositions and methods for the therapy and diagnosis of cytomegalovirus |
09/17/2009 | CA2718499A1 Antibody against the csf-1 r |
09/17/2009 | CA2718382A1 C2orf18 as target gene for cancer therapy and diagnosis |
09/17/2009 | CA2718381A1 Immuno-modulating compositions for the treatment of immune-mediated disorders |
09/17/2009 | CA2718289A1 Anti-tyrp1 antibodies |
09/17/2009 | CA2717997A1 Fusion protein with directioning of vaccinal antigens toward antigen-presenting cells and the applications thereof |
09/17/2009 | CA2717870A1 Chimeric factor h binding proteins (fhbp) containing a heterologous b domain and methods of use |
09/17/2009 | CA2717812A1 Agent for treating disease |
09/17/2009 | CA2717614A1 Antibodies with enhanced adcc function |
09/17/2009 | CA2717221A1 Reagents and methods for detecting influenza virus proteins |
09/17/2009 | CA2716919A1 An anti-cd6 monoclonal antibody and use thereof |
09/17/2009 | CA2715033A1 Immuno-based botulinum toxin serotype a activity assays |
09/17/2009 | CA2711867A1 Use of a protein or nitrated peptide sequence for implementing a diagnosis method |
09/16/2009 | EP2100960A2 Specific polypeptides and nucleic acids of pathogenic strains of the Neisseria genus |
09/16/2009 | EP2100959A2 Mammalian cytokine: interleukin-B30 and related reagents |
09/16/2009 | EP2100958A1 Fluorescent proteins and chromoproteins from non-aequorea hydrozoa species and methods for using same |
09/16/2009 | EP2100903A2 Anti-idiotypic antibodies neutralising the inhibiting activity of an inhibiting antibody directed against domain C1 of factor VIII |
09/16/2009 | EP2100902A1 Methods for treating pain by administering an antagonist antibody against the nerve growth factor and an opioid analgesic, and compositions containing the same |
09/16/2009 | EP2100619A1 Anti-CD70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
09/16/2009 | EP2100618A2 PDGFR-alpha antagonists for treatment of metastatic bone cancer |
09/16/2009 | EP2100617A1 Methods of modulating CD200 receptors |
09/16/2009 | EP2100614A2 PDGFR-alpha antagonists for treatment of metastatic bone cancer |
09/16/2009 | EP2100146A1 Adiponectin antibodies and methods to measure adiponectin |
09/16/2009 | EP2099913A1 Variants of vegfr and their use in the diagnosis and treatment of pregnancy associated medical conditions |
09/16/2009 | EP2099827A2 Antagonist anti-notch3 antibodies and their use in the prevention and treatment of notch3-related diseases |
09/16/2009 | EP2099826A1 Method of providing disease-specific binding molecules and targets |
09/16/2009 | EP2099825A2 Recombinant antibodies against hepatitis c virus and methods of obtaining and using same |
09/16/2009 | EP2099823A2 Variant target binding agents and uses thereof |
09/16/2009 | EP2099822A2 Antibody to the epitope grwirtqqhyyerdpkriyylslefymgrtlqntm or ifnqkivngwqveeaddwlrygnpwekarp or glgdvaevrksfnrhlhftlvkdrnvatprdyffa or dsmatlglaaygygiryefg |