| Patents for C07K 14 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof (291,526) |
|---|
| 06/29/2006 | US20060141042 Hollow nanoparticle having modified cysteine residue and drug with the use thereof |
| 06/29/2006 | US20060140982 Tuberculosis nucleic acids, polypeptides and immunogenic compositions |
| 06/29/2006 | US20060140980 Immunization of non-human mammals against streptococcus equi |
| 06/29/2006 | US20060140979 Antigenic polypeptides |
| 06/29/2006 | US20060140978 Constitutive transport enhancer (CTE); Rev Responsive element (RRE); coding sequence for HIV-1 Rev, and a coding sequence for a desired protein that comprises a coding sequence for an HIV structural protein that includes an RRE and at least one CTE; genetic vaccines, gene therapy |
| 06/29/2006 | US20060140972 Staphylococcus saprophyticus nucleic acids and polypeptides |
| 06/29/2006 | US20060140971 Cell surface expression vector of sars virus antigen and microorganisms transformed thereby |
| 06/29/2006 | US20060140969 Hypoallergenic polypeptides based on fish parvalbumin |
| 06/29/2006 | US20060140968 Tumor antigen peptide that is a fragment of a protein and binds to an HLA-A24 antigen and is recognized by cytotoxic T lymphocytes; use in medicaments, prophylactics or diagnostics for tumors that utilize in vivo or in vitro such tumor antigen protein, genes, tumor antigen peptides, or derivatives |
| 06/29/2006 | US20060140967 Immunotherapy; detecting CD8 expressing T cells; biodrugs generate an immune response to breast cancer and prostate cancer cells that express TARP (T cell receptor gamma Alternate Reading Frame Protein); vaccines |
| 06/29/2006 | US20060140959 Old-35, a gene associated with senescence and terminal cell differentiation, and uses thereof |
| 06/29/2006 | US20060140958 Tumor antigen (TAG); labeled nucleotide sequence; gives rise to antigenic peptides which bind to major histocompatibility complex and recognized by cytotoxic lymphocytes; diagnosis and treatment of cancer |
| 06/29/2006 | US20060140956 Method and compounds for inhibiting hec1 ativity for the treatment of proliferative diseases |
| 06/29/2006 | US20060140950 Using interleukin-23 modulators to treat and prevent nervous system, gastrointestinal and autoimmune disorders |
| 06/29/2006 | US20060140949 IgG4 constant region; Fab' fragment; antibody or antigen binding fragment inhibits binding of A2 or cA2 to human TNF- alpha , and binds to a neutralizing epitope of human TNF- alpha; immunoassays and immunotherapeutic agent |
| 06/29/2006 | US20060140946 Anti-TNF chimeric antibody fragments |
| 06/29/2006 | US20060140945 Nephropathy-associated gene |
| 06/29/2006 | US20060140944 Novel polypeptides involved in immune response |
| 06/29/2006 | US20060140942 Human G-protein coupled receptor (HETGQ23) |
| 06/29/2006 | US20060140941 Growth differentiation factor-3 |
| 06/29/2006 | US20060140938 peroxisome proliferator activated receptor |
| 06/29/2006 | US20060140937 B7-related nucleic acids and polypeptides useful for immunomodulation |
| 06/29/2006 | US20060140935 Platlet glycoprotein Ib alpha fusion polypeptides and methods of use thereof |
| 06/29/2006 | US20060140933 Compositions and methods for treating rage-associated disorders |
| 06/29/2006 | US20060140929 reduced immunogenic potential; consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE |
| 06/29/2006 | US20060140919 Methods for selectively stimulating proliferation of T cells |
| 06/29/2006 | US20060140910 Recombinant adenoviral vectors and methods of use |
| 06/29/2006 | US20060140905 Chemokine beta-7 variants |
| 06/29/2006 | CA2799802A1 Antibodies directed to angiopoietin-2 and uses thereof |
| 06/29/2006 | CA2594557A1 Modified human growth hormone |
| 06/29/2006 | CA2594541A1 Plants having increased yield and method for making the same |
| 06/29/2006 | CA2594053A1 Vacuole targeting peptide and nucleic acid |
| 06/29/2006 | CA2593979A1 Compositions and methods for promoting wound healing and tissue regeneration |
| 06/29/2006 | CA2593964A1 Conjugation product |
| 06/29/2006 | CA2593956A1 Agents inhibiting the cathelin-like protein cap18/ll-37 |
| 06/29/2006 | CA2593922A1 Recombinant production of serum albumin |
| 06/29/2006 | CA2593746A1 Compositions of influenza viral proteins and methods of use thereof |
| 06/29/2006 | CA2592390A1 Methods for producing soluble multi-membrane-spanning proteins |
| 06/29/2006 | CA2592201A1 Neuromedin s and the use thereof |
| 06/29/2006 | CA2592153A1 Resistance genes |
| 06/29/2006 | CA2592054A1 Reduction of the content of protein contaminants in compositions comprising a vitamin k-dependent protein of interest |
| 06/29/2006 | CA2592040A1 Michael-type addition reaction functionalised peg hydrogels with factor xiiia incorporated biofactors |
| 06/29/2006 | CA2592014A1 Purified rhigf-i/rhigfbp-3 complexes and their method of manufacture |
| 06/29/2006 | CA2591992A1 Compositions and methods for producing recombinant proteins |
| 06/29/2006 | CA2591871A1 Target physiological function inactivator using photosensitizer-labeled fluorescent protein |
| 06/29/2006 | CA2591813A1 Anti-il-12 antibodies, epitopes, compositions, methods and uses |
| 06/29/2006 | CA2591786A1 Prevention of thrombus formation and/or stabilization |
| 06/29/2006 | CA2591510A1 Group b streptococcus |
| 06/29/2006 | CA2591274A1 Human cancer suppressor gene, protein encoded therein, expression vector containing the same, and cell transformed by the vector |
| 06/29/2006 | CA2591235A1 Process for preparing high levels of interferon beta |
| 06/29/2006 | CA2590936A1 Combination therapy for b cell disorders |
| 06/29/2006 | CA2590750A1 Myd88 homodimerization inhibitors |
| 06/29/2006 | CA2590461A1 Bcma polypeptides and uses thereof |
| 06/29/2006 | CA2590446A1 Cc-chemokine antagonists |
| 06/29/2006 | CA2589901A1 New mannoprotein with full solubility in wine and its application in the stabilisation of wine |
| 06/29/2006 | CA2589716A1 Low cell density fermentation process for the production of heterologous recombinant proteins in microorganisms |
| 06/29/2006 | CA2589647A1 Glp-1 analog fusion protein formulations |
| 06/29/2006 | CA2572389A1 Vaccine compositions for treating coronavirus infection |
| 06/28/2006 | EP1674576A1 Recombinant allergen with reduced enzymatic activity |
| 06/28/2006 | EP1674575A2 Ligand for herpes simplex virus entry mediator and methods of use |
| 06/28/2006 | EP1674567A1 METHOD OF CLEAVING POLYPEPTIDE BY USING OmpT PROTEASE MUTANT |
| 06/28/2006 | EP1674564A1 Antibody against nox1 polypeptide, method of diagnosing cancer with the use of nox1 gene and method of screening cancer growth inhibitor |
| 06/28/2006 | EP1674479A1 Modulation of Fc Gamma receptors for optimizing immunotherapy |
| 06/28/2006 | EP1674478A1 Fusion proteins and method for determining protein-protein-interactions in living cells and cell lysates, nucleic acids encoding these fusion proteins, as well as vectors and kits containing these |
| 06/28/2006 | EP1674477A2 Binding polypeptides for B lymphocyte stimulator protein (BLYS) |
| 06/28/2006 | EP1674111A1 Anti-glypican 3 antibody |
| 06/28/2006 | EP1674108A2 Osteoporosis treatment |
| 06/28/2006 | EP1673633A1 Method and device for detecting feline immunodeficiency virus |
| 06/28/2006 | EP1673630A2 Mn/ca ix and cancer prognosis |
| 06/28/2006 | EP1673625A2 Generation of stabilized proteins by combinatorial consensus mutagenesis |
| 06/28/2006 | EP1673475A2 Compositions for diagnosis and therapy of diseases associated with aberrant expression of futrins (r-spondins) and/or wnt |
| 06/28/2006 | EP1673464A2 Conjugation of peptides |
| 06/28/2006 | EP1673462A2 Plant transcriptional regulators of abiotic stress |
| 06/28/2006 | EP1673461A1 Chimeric carrier molecules for the production of mucosal vaccines |
| 06/28/2006 | EP1673460A1 Recombinant vaccines and use thereof |
| 06/28/2006 | EP1673458A1 Poxvirus vector encoding retrovirus (eg hiv) and cytokine |
| 06/28/2006 | EP1673456A1 Soluble ectodomain fragments of met and uses thereof |
| 06/28/2006 | EP1673449A2 Immunogenic composition and method of developing a vaccine based on fusion protein |
| 06/28/2006 | EP1673448A2 Immunogenic compostion and method of developing a vaccine based on psoralen inactivated hiv |
| 06/28/2006 | EP1673447A1 Immunogenic composition and method of developing a vaccine based on portions of the hiv matrix protein |
| 06/28/2006 | EP1673444A2 Control of es cell self-renewal and lineage specification, and medium therefor |
| 06/28/2006 | EP1673441A2 Long-wavelength fps |
| 06/28/2006 | EP1673438A2 Transgenic rodents selectively expressing human b1 bradykinin receptor protein |
| 06/28/2006 | EP1673436A2 Nucleic acid molecules encoding novel human low-voltage activated calcium channel proteins, designated - alpha 1i-1 and alpha 1i-2, encoded proteins and methods of use thereof |
| 06/28/2006 | EP1673395A1 Alteration of fc-fusion protein serum half-lives by mutagenesis of positions 250, 314 and/or 428 of the heavy chain constant region of ig |
| 06/28/2006 | EP1673394A2 Altering a b cell pathology using self-derived antigens in conjunction with specific-binding cytoreductive agent |
| 06/28/2006 | EP1673391A1 MODIFIED cDNA FOR HIGH EXPRESSION LEVELS OF FACTOR VIII AND ITS DERIVATIVES |
| 06/28/2006 | EP1673390A2 Ztnfr14, A TUMOR NECROSIS FACTOR RECEPTOR |
| 06/28/2006 | EP1673389A2 Novel variants of cd40l protein |
| 06/28/2006 | EP1673388A2 Novel cxcl8 antagonists |
| 06/28/2006 | EP1673387A1 Il-21 derivatives |
| 06/28/2006 | EP1673386A2 Stabilized alpha-helical peptides |
| 06/28/2006 | EP1673155A2 Method for the dissociation of the extracellular haemoglobin molecule of arenicola marina and the characterisation of the protein chains forming the molecule and the nucleotide sequences coding for said protein chains |
| 06/28/2006 | EP1673108A2 Methods and compositions for ultrasound imaging of apoptosis |
| 06/28/2006 | EP1673106A1 Optimized expression of hpv 45 l1 in yeast |
| 06/28/2006 | EP1673103A1 Therapeutic uses of chemokine variants |
| 06/28/2006 | EP1673101A1 Lim2 inhibitors of lmo2 |
| 06/28/2006 | EP1673099A1 Compositions and methods for inhibiting cell senescence and hyperproliferative disorders |
| 06/28/2006 | EP1597370B1 Rhesus carcino embryonic antigen, nucleotides encoding same, and uses thereof |
| 06/28/2006 | EP1578971A4 Stress-related polypeptides and uses therefor |