Patents
Patents for C07K 14 - Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof (291,526)
06/2006
06/29/2006US20060141042 Hollow nanoparticle having modified cysteine residue and drug with the use thereof
06/29/2006US20060140982 Tuberculosis nucleic acids, polypeptides and immunogenic compositions
06/29/2006US20060140980 Immunization of non-human mammals against streptococcus equi
06/29/2006US20060140979 Antigenic polypeptides
06/29/2006US20060140978 Constitutive transport enhancer (CTE); Rev Responsive element (RRE); coding sequence for HIV-1 Rev, and a coding sequence for a desired protein that comprises a coding sequence for an HIV structural protein that includes an RRE and at least one CTE; genetic vaccines, gene therapy
06/29/2006US20060140972 Staphylococcus saprophyticus nucleic acids and polypeptides
06/29/2006US20060140971 Cell surface expression vector of sars virus antigen and microorganisms transformed thereby
06/29/2006US20060140969 Hypoallergenic polypeptides based on fish parvalbumin
06/29/2006US20060140968 Tumor antigen peptide that is a fragment of a protein and binds to an HLA-A24 antigen and is recognized by cytotoxic T lymphocytes; use in medicaments, prophylactics or diagnostics for tumors that utilize in vivo or in vitro such tumor antigen protein, genes, tumor antigen peptides, or derivatives
06/29/2006US20060140967 Immunotherapy; detecting CD8 expressing T cells; biodrugs generate an immune response to breast cancer and prostate cancer cells that express TARP (T cell receptor gamma Alternate Reading Frame Protein); vaccines
06/29/2006US20060140959 Old-35, a gene associated with senescence and terminal cell differentiation, and uses thereof
06/29/2006US20060140958 Tumor antigen (TAG); labeled nucleotide sequence; gives rise to antigenic peptides which bind to major histocompatibility complex and recognized by cytotoxic lymphocytes; diagnosis and treatment of cancer
06/29/2006US20060140956 Method and compounds for inhibiting hec1 ativity for the treatment of proliferative diseases
06/29/2006US20060140950 Using interleukin-23 modulators to treat and prevent nervous system, gastrointestinal and autoimmune disorders
06/29/2006US20060140949 IgG4 constant region; Fab' fragment; antibody or antigen binding fragment inhibits binding of A2 or cA2 to human TNF- alpha , and binds to a neutralizing epitope of human TNF- alpha; immunoassays and immunotherapeutic agent
06/29/2006US20060140946 Anti-TNF chimeric antibody fragments
06/29/2006US20060140945 Nephropathy-associated gene
06/29/2006US20060140944 Novel polypeptides involved in immune response
06/29/2006US20060140942 Human G-protein coupled receptor (HETGQ23)
06/29/2006US20060140941 Growth differentiation factor-3
06/29/2006US20060140938 peroxisome proliferator activated receptor
06/29/2006US20060140937 B7-related nucleic acids and polypeptides useful for immunomodulation
06/29/2006US20060140935 Platlet glycoprotein Ib alpha fusion polypeptides and methods of use thereof
06/29/2006US20060140933 Compositions and methods for treating rage-associated disorders
06/29/2006US20060140929 reduced immunogenic potential; consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE
06/29/2006US20060140919 Methods for selectively stimulating proliferation of T cells
06/29/2006US20060140910 Recombinant adenoviral vectors and methods of use
06/29/2006US20060140905 Chemokine beta-7 variants
06/29/2006CA2799802A1 Antibodies directed to angiopoietin-2 and uses thereof
06/29/2006CA2594557A1 Modified human growth hormone
06/29/2006CA2594541A1 Plants having increased yield and method for making the same
06/29/2006CA2594053A1 Vacuole targeting peptide and nucleic acid
06/29/2006CA2593979A1 Compositions and methods for promoting wound healing and tissue regeneration
06/29/2006CA2593964A1 Conjugation product
06/29/2006CA2593956A1 Agents inhibiting the cathelin-like protein cap18/ll-37
06/29/2006CA2593922A1 Recombinant production of serum albumin
06/29/2006CA2593746A1 Compositions of influenza viral proteins and methods of use thereof
06/29/2006CA2592390A1 Methods for producing soluble multi-membrane-spanning proteins
06/29/2006CA2592201A1 Neuromedin s and the use thereof
06/29/2006CA2592153A1 Resistance genes
06/29/2006CA2592054A1 Reduction of the content of protein contaminants in compositions comprising a vitamin k-dependent protein of interest
06/29/2006CA2592040A1 Michael-type addition reaction functionalised peg hydrogels with factor xiiia incorporated biofactors
06/29/2006CA2592014A1 Purified rhigf-i/rhigfbp-3 complexes and their method of manufacture
06/29/2006CA2591992A1 Compositions and methods for producing recombinant proteins
06/29/2006CA2591871A1 Target physiological function inactivator using photosensitizer-labeled fluorescent protein
06/29/2006CA2591813A1 Anti-il-12 antibodies, epitopes, compositions, methods and uses
06/29/2006CA2591786A1 Prevention of thrombus formation and/or stabilization
06/29/2006CA2591510A1 Group b streptococcus
06/29/2006CA2591274A1 Human cancer suppressor gene, protein encoded therein, expression vector containing the same, and cell transformed by the vector
06/29/2006CA2591235A1 Process for preparing high levels of interferon beta
06/29/2006CA2590936A1 Combination therapy for b cell disorders
06/29/2006CA2590750A1 Myd88 homodimerization inhibitors
06/29/2006CA2590461A1 Bcma polypeptides and uses thereof
06/29/2006CA2590446A1 Cc-chemokine antagonists
06/29/2006CA2589901A1 New mannoprotein with full solubility in wine and its application in the stabilisation of wine
06/29/2006CA2589716A1 Low cell density fermentation process for the production of heterologous recombinant proteins in microorganisms
06/29/2006CA2589647A1 Glp-1 analog fusion protein formulations
06/29/2006CA2572389A1 Vaccine compositions for treating coronavirus infection
06/28/2006EP1674576A1 Recombinant allergen with reduced enzymatic activity
06/28/2006EP1674575A2 Ligand for herpes simplex virus entry mediator and methods of use
06/28/2006EP1674567A1 METHOD OF CLEAVING POLYPEPTIDE BY USING OmpT PROTEASE MUTANT
06/28/2006EP1674564A1 Antibody against nox1 polypeptide, method of diagnosing cancer with the use of nox1 gene and method of screening cancer growth inhibitor
06/28/2006EP1674479A1 Modulation of Fc Gamma receptors for optimizing immunotherapy
06/28/2006EP1674478A1 Fusion proteins and method for determining protein-protein-interactions in living cells and cell lysates, nucleic acids encoding these fusion proteins, as well as vectors and kits containing these
06/28/2006EP1674477A2 Binding polypeptides for B lymphocyte stimulator protein (BLYS)
06/28/2006EP1674111A1 Anti-glypican 3 antibody
06/28/2006EP1674108A2 Osteoporosis treatment
06/28/2006EP1673633A1 Method and device for detecting feline immunodeficiency virus
06/28/2006EP1673630A2 Mn/ca ix and cancer prognosis
06/28/2006EP1673625A2 Generation of stabilized proteins by combinatorial consensus mutagenesis
06/28/2006EP1673475A2 Compositions for diagnosis and therapy of diseases associated with aberrant expression of futrins (r-spondins) and/or wnt
06/28/2006EP1673464A2 Conjugation of peptides
06/28/2006EP1673462A2 Plant transcriptional regulators of abiotic stress
06/28/2006EP1673461A1 Chimeric carrier molecules for the production of mucosal vaccines
06/28/2006EP1673460A1 Recombinant vaccines and use thereof
06/28/2006EP1673458A1 Poxvirus vector encoding retrovirus (eg hiv) and cytokine
06/28/2006EP1673456A1 Soluble ectodomain fragments of met and uses thereof
06/28/2006EP1673449A2 Immunogenic composition and method of developing a vaccine based on fusion protein
06/28/2006EP1673448A2 Immunogenic compostion and method of developing a vaccine based on psoralen inactivated hiv
06/28/2006EP1673447A1 Immunogenic composition and method of developing a vaccine based on portions of the hiv matrix protein
06/28/2006EP1673444A2 Control of es cell self-renewal and lineage specification, and medium therefor
06/28/2006EP1673441A2 Long-wavelength fps
06/28/2006EP1673438A2 Transgenic rodents selectively expressing human b1 bradykinin receptor protein
06/28/2006EP1673436A2 Nucleic acid molecules encoding novel human low-voltage activated calcium channel proteins, designated - alpha 1i-1 and alpha 1i-2, encoded proteins and methods of use thereof
06/28/2006EP1673395A1 Alteration of fc-fusion protein serum half-lives by mutagenesis of positions 250, 314 and/or 428 of the heavy chain constant region of ig
06/28/2006EP1673394A2 Altering a b cell pathology using self-derived antigens in conjunction with specific-binding cytoreductive agent
06/28/2006EP1673391A1 MODIFIED cDNA FOR HIGH EXPRESSION LEVELS OF FACTOR VIII AND ITS DERIVATIVES
06/28/2006EP1673390A2 Ztnfr14, A TUMOR NECROSIS FACTOR RECEPTOR
06/28/2006EP1673389A2 Novel variants of cd40l protein
06/28/2006EP1673388A2 Novel cxcl8 antagonists
06/28/2006EP1673387A1 Il-21 derivatives
06/28/2006EP1673386A2 Stabilized alpha-helical peptides
06/28/2006EP1673155A2 Method for the dissociation of the extracellular haemoglobin molecule of arenicola marina and the characterisation of the protein chains forming the molecule and the nucleotide sequences coding for said protein chains
06/28/2006EP1673108A2 Methods and compositions for ultrasound imaging of apoptosis
06/28/2006EP1673106A1 Optimized expression of hpv 45 l1 in yeast
06/28/2006EP1673103A1 Therapeutic uses of chemokine variants
06/28/2006EP1673101A1 Lim2 inhibitors of lmo2
06/28/2006EP1673099A1 Compositions and methods for inhibiting cell senescence and hyperproliferative disorders
06/28/2006EP1597370B1 Rhesus carcino embryonic antigen, nucleotides encoding same, and uses thereof
06/28/2006EP1578971A4 Stress-related polypeptides and uses therefor