| Patents for C07H 21 - Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids (89,892) |
|---|
| 06/29/2006 | US20060142236 Antisense oligonucleotide modulation of raf gene expression |
| 06/29/2006 | US20060142230 Double-stranded ribonucleic acid molecules having ribothymidine |
| 06/29/2006 | US20060142228 Methods and compositions concerning siRNA's as mediators of RNA interference |
| 06/29/2006 | US20060142227 Amphiphylic peptide-PNA conjugates for the delivery of PNA through the blood brain barrier |
| 06/29/2006 | US20060142226 siNA molecule comprising a double-stranded structure that down-regulates expression of cholesteryl ester transfer protein (CETP) , wherein said siNA molecule does not require the presence of nucleotides having a 2'-hydroxy group within the siNA molecule for mediating RNA interference |
| 06/29/2006 | US20060142225 siNA molecule comprising a double-stranded structure that down-regulates expression of cyclin dependent kinase-2 (CDK2) , wherein said siNA molecule does not require the presence of nucleotides having a 2'-hydroxy group within the siNA molecule for mediating RNA interference |
| 06/29/2006 | US20060142224 Modulation of immunostimulatory activity of immunostimulatory oligonucleotide analogs by positional chemical changes |
| 06/29/2006 | US20060142222 Novel gene relating to fibrotic conditions |
| 06/29/2006 | US20060142221 Vaccine |
| 06/29/2006 | US20060142218 Method of controlling telomere length |
| 06/29/2006 | US20060142199 CD-44 like protein |
| 06/29/2006 | US20060142196 Soluble GDNFR (Glial-cell Derived Neurotrophic Factor) that retains both ligand binding, and receptor signaling function (via Ret receptor tyrosine kinase) used to impart, restore, or enhance GDNFR alpha -ligand (preferably GDNF) responsiveness to cells; kidney diseases |
| 06/29/2006 | US20060142189 polypeptides derived from the ankyrin binding domain of the L1-cellular adhesion molecules (L1-CAM), used in the treatment of strokes,neurodegenerative disease, spinal cord and brain injuries |
| 06/29/2006 | US20060142188 Monkey alpha-7 nicotinic acetylcholine receptor and methods of use thereof |
| 06/29/2006 | US20060142171 Novel alkaline protease |
| 06/29/2006 | US20060141625 Expression cassette and vector for transient or stable expression of exogenous molecules |
| 06/29/2006 | US20060141602 Packaging of positive-strand RNA virus replicon particles |
| 06/29/2006 | US20060141601 Detergent; polypeptides |
| 06/29/2006 | US20060141597 Valency platform molecules comprising aminooxy groups |
| 06/29/2006 | US20060141583 Strain of Streptomyces in which a polyketide synthase gene encoding a polypeptide having the amino acid sequence of SEQ ID NO:14 within an elaiophylin gene cluster is disrupted by the recombinant substitution |
| 06/29/2006 | US20060141581 IL-7 variants with reduced immunogenicity |
| 06/29/2006 | US20060141580 Encoding protein with immunomodulatory activity, antiviral activity, and antitumor activity; treating any Type 1 interferon treatable disease including cancer; determining if a patient will respond to interferon treatment; transgenic animals |
| 06/29/2006 | US20060141579 Cytokine zcytor17 ligand polynucleotides |
| 06/29/2006 | US20060141577 Selection of host cells expressing protein at high levels |
| 06/29/2006 | US20060141576 Variants of corticotropin releasing hormone receptor type 1 and uses thereof |
| 06/29/2006 | US20060141575 Secreted proteins and nucleic acids encoding them |
| 06/29/2006 | US20060141573 Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same |
| 06/29/2006 | US20060141570 Intein-mediated protein purification using in vivo expression of an aggregator protein |
| 06/29/2006 | US20060141569 Compositions and methods for the assay of G-protein coupled receptors and their ligands |
| 06/29/2006 | US20060141568 Modification of collagenous materials and medical treatment, diagnosis and monitoring of fibrotic conditions |
| 06/29/2006 | US20060141567 For selective modulation of leukocyte function, which is useful in a variety of inflammatory and autoimmune diseases, or in therapy of infections |
| 06/29/2006 | US20060141565 Novel fibroblast growth factor and uses thereof |
| 06/29/2006 | US20060141564 Nucleic acids encoding duramycin |
| 06/29/2006 | US20060141563 Mutant protein and refolding method |
| 06/29/2006 | US20060141562 Mutant E. coli appa phytase enzymes and natural variants thereof, nucleic acids encoding such phytase enzymes, vectors and host cells incorporating same and methods of making and using same |
| 06/29/2006 | US20060141561 Apo-2 ligand/trail variants and uses thereof |
| 06/29/2006 | US20060141560 Estrogen receptor genes and utilization thereof |
| 06/29/2006 | US20060141558 Bioproduction of astaxanthin using mutant carotenoid ketolase and carotenoid hydroxylase genes |
| 06/29/2006 | US20060141524 Novel kinases and uses thereof |
| 06/29/2006 | US20060141522 Screening methods for identifying agonists and antagonists of hereulin -like factor (HLF) activity; diagnostic methods for detecting disorders of the regulation of cell growth and therapeutic methods for treating disorders of the regulation |
| 06/29/2006 | US20060141517 Protein having PDZ domain sequence |
| 06/29/2006 | US20060141515 Polynucleotides encoding plant cysteine proteases |
| 06/29/2006 | US20060141514 Thermus brockianus nucleic acid polymerases |
| 06/29/2006 | US20060141511 Chemical amplification for the synthesis of patterned arrays |
| 06/29/2006 | US20060141502 Methods and compositions for the preparation and use of fixed-treated cell-lines and tissue in fluorescence in situ hybridization |
| 06/29/2006 | US20060141492 Gene probes for the selective detection of microorganisms that reductively dechlorinate polychlorinated biphenyl compounds |
| 06/29/2006 | US20060141491 Compositions and methods for enhancing polynucleotide amplification reactions |
| 06/29/2006 | US20060141488 Method for stabilizing or preserving nucleic acid by using amino surfactants |
| 06/29/2006 | US20060141479 Diagnosis, psoriasis, rheumatoid arthritis, emphysema, asthma, diabetes, autoimmune thyroiditis, inflammatory bowel diseases, including Crohn's disease and ulcerative colitis, different types of dermatitis including allergic dermatitis, contact dermatitis, actinic keratosis, wound healing, cancer |
| 06/29/2006 | US20060141478 Methods and compositions for detecting and treating genetically induced chronic diseases |
| 06/29/2006 | US20060141476 Growth arrest homeobox gene |
| 06/29/2006 | US20060141473 Erk7 and erk8, novel diagnostic markers for cancer |
| 06/29/2006 | US20060141468 Novel notch-like polypeptides |
| 06/29/2006 | US20060141457 Nucleotide sequence encoding an acyltransferase polypeptide comprising membrane-spanning region; immobilization, freeze drying; contacting vegetable oil with polypeptide wherein fatty acids are transferred from phospholipid to an acceptor molecule; ester interchange; lecithin is converted to lysolecithin |
| 06/29/2006 | US20060141453 Prokineticin polypeptides, related compositions and methods |
| 06/29/2006 | US20060141451 Guinea pig proteinase-activated receptor 4 and its activating peptide |
| 06/29/2006 | US20060141020 Liposomes containing oligonucleotides |
| 06/29/2006 | US20060140982 Tuberculosis nucleic acids, polypeptides and immunogenic compositions |
| 06/29/2006 | US20060140972 Staphylococcus saprophyticus nucleic acids and polypeptides |
| 06/29/2006 | US20060140969 Hypoallergenic polypeptides based on fish parvalbumin |
| 06/29/2006 | US20060140967 Immunotherapy; detecting CD8 expressing T cells; biodrugs generate an immune response to breast cancer and prostate cancer cells that express TARP (T cell receptor gamma Alternate Reading Frame Protein); vaccines |
| 06/29/2006 | US20060140959 Old-35, a gene associated with senescence and terminal cell differentiation, and uses thereof |
| 06/29/2006 | US20060140958 Tumor antigen (TAG); labeled nucleotide sequence; gives rise to antigenic peptides which bind to major histocompatibility complex and recognized by cytotoxic lymphocytes; diagnosis and treatment of cancer |
| 06/29/2006 | US20060140954 Novel human protein kinases and protein kinase-like enzymes |
| 06/29/2006 | US20060140944 Novel polypeptides involved in immune response |
| 06/29/2006 | US20060140942 Human G-protein coupled receptor (HETGQ23) |
| 06/29/2006 | US20060140937 B7-related nucleic acids and polypeptides useful for immunomodulation |
| 06/29/2006 | US20060140929 reduced immunogenic potential; consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE |
| 06/29/2006 | US20060140905 Chemokine beta-7 variants |
| 06/29/2006 | US20060140875 Semi-soft C-class immunostimulatory oligonucleotides |
| 06/29/2006 | CA2594557A1 Modified human growth hormone |
| 06/29/2006 | CA2592104A1 Enzymes for starch processing |
| 06/29/2006 | CA2592099A1 Conserved hbv and hcv sequences useful for gene silencing |
| 06/29/2006 | CA2591745A1 Polypeptides having glucoamylase activity and polynucleotides encoding same |
| 06/28/2006 | EP1674581A1 Twin probes, a tool for the detection of SNPs |
| 06/28/2006 | EP1674574A1 Methods for Regulating Hematopoiesis using CpG-Oligonucleotides |
| 06/28/2006 | EP1674573A1 RNA-sequence or nucleoside/nucleotide analogues and method for producing the analogues |
| 06/28/2006 | EP1674571A2 Use of paramagnetic material in the purification and manipulation of nucleic acids |
| 06/28/2006 | EP1674570A2 Method of isolating nucleic acid using material positively charged at first pH and containing amino group and carboxyl group |
| 06/28/2006 | EP1673480A2 Use of photopolymerization for amplification and detection of a molecular recognition event |
| 06/28/2006 | EP1673478A2 Competition assay for identifying modulators of quadruplex nucleic acids |
| 06/28/2006 | EP1673476A1 Apparatus and methods for detecting nucleic acid in biological samples |
| 06/28/2006 | EP1673459A2 Luciferase biosensor |
| 06/28/2006 | EP1673450A1 Vitamin k epoxide recycling polypeptide vkorc1, a therapeutic target of coumarin and their derivatives |
| 06/28/2006 | EP1673441A2 Long-wavelength fps |
| 06/28/2006 | EP1673437A2 Compositions and methods for synthesizing, purifying and detecting biomolecules |
| 06/28/2006 | EP1673383A2 Genetic markers for obesity |
| 06/28/2006 | EP1673382A1 Adrenergic receptor snp for improved milking characteristics |
| 06/28/2006 | EP1673381A2 Solid phase methods for polynucleotide production |
| 06/28/2006 | EP1673380A2 Method for preparing a modified host cell |
| 06/28/2006 | EP1673054A2 Transition state analog inhibitors of ricin a-chain |
| 06/28/2006 | EP1579004A4 Screening methods for identification of efficient pre-trans-splicing molecules |
| 06/28/2006 | EP1556403A4 Multimeric protein engineering |
| 06/28/2006 | EP1507874A4 Compositions and processes for inhibiting gene expression using polynucleotides |
| 06/28/2006 | EP1156789B9 Therapy for human cancers using cisplatin and other drugs or genes encapsulated into liposomes |
| 06/28/2006 | EP1105515B1 Alpha 2,8/2,9 polysialyltransferase |
| 06/28/2006 | EP0935604B1 Magnetically activated cell sorting for production of proteins |
| 06/28/2006 | EP0897426B1 Matrix metalloprotease |
| 06/28/2006 | EP0797676B9 Recombinant adenoviral vector and methods of use |
| 06/28/2006 | EP0712414B1 Recombinant vector containing a lipoprotein gene sequence for expressing nucleotide sequences |