| Patents for A61K 38 - Medicinal preparations containing peptides (316,240) |
|---|
| 06/29/2006 | US20060142190 Administering fragment of Herpoxin which contains the active domain for therapy of infective condition caused by DNA virus or T. bacilli |
| 06/29/2006 | US20060142189 polypeptides derived from the ankyrin binding domain of the L1-cellular adhesion molecules (L1-CAM), used in the treatment of strokes,neurodegenerative disease, spinal cord and brain injuries |
| 06/29/2006 | US20060142188 Monkey alpha-7 nicotinic acetylcholine receptor and methods of use thereof |
| 06/29/2006 | US20060142187 Methods for modulating cell-to-cell adhesion using an agonist of C1INH-type protein activity |
| 06/29/2006 | US20060142186 Administering a synergistic combination of a gonadotropin releasing hormone analog, leuprolide acetate, and either or both of an acetylcholinesterase inhibitor donepezil, rivastigimine, galantamine, and/or tacrine and an N-methyl-D-aspartate receptor antagon , memantine; sex steroid antagonists |
| 06/29/2006 | US20060142185 Use of lupin conglutin for the treatment of type II diabetes |
| 06/29/2006 | US20060142184 Protein based oral lubricant |
| 06/29/2006 | US20060142183 Method and composition for treatment and/or prevention of antibiotic-resistant microorganism infections |
| 06/29/2006 | US20060142182 May be coupled with endorphin, enkephalin, dynorphin or endomorphin; for traversing blood brain barrier, for therapy of neuronal disorders |
| 06/29/2006 | US20060142181 Compound and method of treating neurogenic conditions using non-steroidal anti-inflammatory drug complexes |
| 06/29/2006 | US20060142180 Cholinergic modulation of microglial activation via alpha-7 nicotinic receptors |
| 06/29/2006 | US20060142179 4-aminopyridine and a pharmaceutical composition for treatment of neuronal disorders |
| 06/29/2006 | US20060142178 Method of treating cancer |
| 06/29/2006 | US20060141602 Packaging of positive-strand RNA virus replicon particles |
| 06/29/2006 | US20060141598 Promotion of peroxisomal catalase function in cells |
| 06/29/2006 | US20060141580 Encoding protein with immunomodulatory activity, antiviral activity, and antitumor activity; treating any Type 1 interferon treatable disease including cancer; determining if a patient will respond to interferon treatment; transgenic animals |
| 06/29/2006 | US20060141579 Cytokine zcytor17 ligand polynucleotides |
| 06/29/2006 | US20060141576 Variants of corticotropin releasing hormone receptor type 1 and uses thereof |
| 06/29/2006 | US20060141575 Secreted proteins and nucleic acids encoding them |
| 06/29/2006 | US20060141573 Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same |
| 06/29/2006 | US20060141568 Modification of collagenous materials and medical treatment, diagnosis and monitoring of fibrotic conditions |
| 06/29/2006 | US20060141567 For selective modulation of leukocyte function, which is useful in a variety of inflammatory and autoimmune diseases, or in therapy of infections |
| 06/29/2006 | US20060141564 Nucleic acids encoding duramycin |
| 06/29/2006 | US20060141561 Apo-2 ligand/trail variants and uses thereof |
| 06/29/2006 | US20060141552 Regulation of human caspase-1-like protease |
| 06/29/2006 | US20060141550 Novel metabolic targets and markers |
| 06/29/2006 | US20060141545 Cancer treatment kits using antibodies to aminophospholipids |
| 06/29/2006 | US20060141535 Hyaluronan receptor for endocytosis |
| 06/29/2006 | US20060141526 Genetic marker for coronary artery disease |
| 06/29/2006 | US20060141524 Novel kinases and uses thereof |
| 06/29/2006 | US20060141517 Protein having PDZ domain sequence |
| 06/29/2006 | US20060141500 Methods and compounds for the diagnosis of inflammatory disease and identification of pharmacological agents useful in the treatment of inflammatory disease |
| 06/29/2006 | US20060141482 Method and multicomponent conjugates for treating cancer |
| 06/29/2006 | US20060141479 Diagnosis, psoriasis, rheumatoid arthritis, emphysema, asthma, diabetes, autoimmune thyroiditis, inflammatory bowel diseases, including Crohn's disease and ulcerative colitis, different types of dermatitis including allergic dermatitis, contact dermatitis, actinic keratosis, wound healing, cancer |
| 06/29/2006 | US20060141477 Use of parvovirus capsid particles in the inhibition of cell proliferation and migration |
| 06/29/2006 | US20060141476 Growth arrest homeobox gene |
| 06/29/2006 | US20060141455 Gene products differentially expressed in cancerous breast cells and their methods of use |
| 06/29/2006 | US20060141453 Prokineticin polypeptides, related compositions and methods |
| 06/29/2006 | US20060141052 Drug microparticles |
| 06/29/2006 | US20060141051 Drug microparticles |
| 06/29/2006 | US20060141050 Drug microparticles |
| 06/29/2006 | US20060141042 Hollow nanoparticle having modified cysteine residue and drug with the use thereof |
| 06/29/2006 | US20060141041 systemic delivery of labile agent to mammal comprising administering by mouth sustained release composition comprising microparticles containing labile agents, biocompatible polymers, and water soluble polymers, for absorption in the gastrointestinal systems; DNA vaccines |
| 06/29/2006 | US20060141040 Injectable non-aqueous suspension |
| 06/29/2006 | US20060141028 Cyclosporin formulations |
| 06/29/2006 | US20060141020 Liposomes containing oligonucleotides |
| 06/29/2006 | US20060141005 Compositions and medical devices utilizing bioabsorbable polymeric waxes |
| 06/29/2006 | US20060141004 Compositions and medical devices utilizing bioabsorbable polymeric waxes |
| 06/29/2006 | US20060140977 Methods for assaying inhibition of HIV-1 envelope glycoprotein-mediated membrane fusion |
| 06/29/2006 | US20060140970 Proteic binding partners of TCTP and methods of modulating tumor reversion or cell apoptosis |
| 06/29/2006 | US20060140969 Hypoallergenic polypeptides based on fish parvalbumin |
| 06/29/2006 | US20060140968 Tumor antigen peptide that is a fragment of a protein and binds to an HLA-A24 antigen and is recognized by cytotoxic T lymphocytes; use in medicaments, prophylactics or diagnostics for tumors that utilize in vivo or in vitro such tumor antigen protein, genes, tumor antigen peptides, or derivatives |
| 06/29/2006 | US20060140957 Eph/ephrin mediated modulation of cell adhesion and tumour cell metastasis |
| 06/29/2006 | US20060140956 Method and compounds for inhibiting hec1 ativity for the treatment of proliferative diseases |
| 06/29/2006 | US20060140952 Tumour necrosis factor binding ligands |
| 06/29/2006 | US20060140951 Tumour necrosis factor binding ligands |
| 06/29/2006 | US20060140950 Using interleukin-23 modulators to treat and prevent nervous system, gastrointestinal and autoimmune disorders |
| 06/29/2006 | US20060140949 IgG4 constant region; Fab' fragment; antibody or antigen binding fragment inhibits binding of A2 or cA2 to human TNF- alpha , and binds to a neutralizing epitope of human TNF- alpha; immunoassays and immunotherapeutic agent |
| 06/29/2006 | US20060140947 Administering decitabine and tyrosine kinase inhibitor such as epidermal growth factor receptor family (EGFR); cancer therapy; chronic myelogenous leukemia |
| 06/29/2006 | US20060140946 Anti-TNF chimeric antibody fragments |
| 06/29/2006 | US20060140945 Nephropathy-associated gene |
| 06/29/2006 | US20060140943 Immunotherapy using modulators of notch signalling |
| 06/29/2006 | US20060140941 Growth differentiation factor-3 |
| 06/29/2006 | US20060140939 Methods for preventing and treating tissue damage associated with ischemia-reperfusion injury |
| 06/29/2006 | US20060140937 B7-related nucleic acids and polypeptides useful for immunomodulation |
| 06/29/2006 | US20060140935 Platlet glycoprotein Ib alpha fusion polypeptides and methods of use thereof |
| 06/29/2006 | US20060140929 reduced immunogenic potential; consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE |
| 06/29/2006 | US20060140928 Use of heparinases to decrease inflammatory response |
| 06/29/2006 | US20060140927 Cytochrome P450 enzyme complexes and methods of treatment using the same |
| 06/29/2006 | US20060140926 Mss4 as an antifungal target |
| 06/29/2006 | US20060140925 Composition of biochemical compounds involved in bioenergy metabolism of cells and method of use |
| 06/29/2006 | US20060140924 Topical composition for application to perianal and/or labial areas of skin which helps prevent viscoelastic fluids, such as menses and feces, from attaching to skin and aids in reducing viscoelastic properties of fluid so that fluid can flow into absorbent articles |
| 06/29/2006 | US20060140923 Semi-synthetic platelet gel and method for the preparation thereof |
| 06/29/2006 | US20060140920 Adenoviral vectors encoding an antibody fused to a CD4 extracellular domain |
| 06/29/2006 | US20060140917 Compositions and methods for selective dissolution of nascent intravascular blood clots |
| 06/29/2006 | US20060140911 Bacteriophage for the treatment of bacterial biofilms |
| 06/29/2006 | US20060140910 Recombinant adenoviral vectors and methods of use |
| 06/29/2006 | US20060140907 Central airway administration for systemic delivery of therapeutics |
| 06/29/2006 | US20060140906 Composition comprising cysteamine for improving immunity of animals |
| 06/29/2006 | US20060140905 Chemokine beta-7 variants |
| 06/29/2006 | US20060140874 Stable aerosol formulations of peptides and protein with non-cfc propellants |
| 06/29/2006 | DE202006004746U1 Desmopressin umfassende Zusammensetzung Desmopressin composition comprising |
| 06/29/2006 | DE10335584B4 Verfahren zur Herstellung zyklischer Moleküle A process for preparing cyclic molecules |
| 06/29/2006 | CA2820728A1 Drug carrier and drug carrier kit for inhibiting fibrosis |
| 06/29/2006 | CA2594557A1 Modified human growth hormone |
| 06/29/2006 | CA2593979A1 Compositions and methods for promoting wound healing and tissue regeneration |
| 06/29/2006 | CA2593964A1 Conjugation product |
| 06/29/2006 | CA2593956A1 Agents inhibiting the cathelin-like protein cap18/ll-37 |
| 06/29/2006 | CA2593922A1 Recombinant production of serum albumin |
| 06/29/2006 | CA2592201A1 Neuromedin s and the use thereof |
| 06/29/2006 | CA2592153A1 Resistance genes |
| 06/29/2006 | CA2592014A1 Purified rhigf-i/rhigfbp-3 complexes and their method of manufacture |
| 06/29/2006 | CA2591871A1 Target physiological function inactivator using photosensitizer-labeled fluorescent protein |
| 06/29/2006 | CA2591786A1 Prevention of thrombus formation and/or stabilization |
| 06/29/2006 | CA2591665A1 Binding molecules capable of neutralizing west nile virus and uses thereof |
| 06/29/2006 | CA2591608A1 Use of botulinum toxin for prolonged local desensitization |
| 06/29/2006 | CA2591344A1 Controlled release of biological entities |
| 06/29/2006 | CA2590936A1 Combination therapy for b cell disorders |
| 06/29/2006 | CA2590750A1 Myd88 homodimerization inhibitors |
| 06/29/2006 | CA2590461A1 Bcma polypeptides and uses thereof |