| Patents for A61K 38 - Medicinal preparations containing peptides (316,240) |
|---|
| 05/24/2007 | WO2006015275A3 Method for enhancing bone formation |
| 05/24/2007 | WO2005107357A3 Analgesic peptides derived from the venom of crotalus durissus terrificuss snakes |
| 05/24/2007 | WO2005046610A3 Genes differentially expressed by acutely isolated resident progenitor cells of the human white matter |
| 05/24/2007 | WO2005013891A3 Vaccines using pattern recognition receptor-ligand:lipid complexes |
| 05/24/2007 | WO2004087071A3 Use of benzyl alcohol, and other phenolic preservatives to reduce pain during intradermal injection |
| 05/24/2007 | WO2004034973A3 Method of treating snoring and other obstructive breathing disorders |
| 05/24/2007 | WO2000009653A3 Method of inhibiting cathepsin k |
| 05/24/2007 | US20070117967 Homogeneous preparations of il-28 and il-29 |
| 05/24/2007 | US20070117825 Use of amide derivative of ge 2270 factor a3 for the treatment of acne |
| 05/24/2007 | US20070117772 Methods for slowing familial ALS disease progression |
| 05/24/2007 | US20070117771 VGLUT-specific dsRNA compounds |
| 05/24/2007 | US20070117760 such as N-[5-({[5-({[3-(Dimethylamino)propyl]amino}carbonyl)-1-methyl-1H-pyrrol3-yl]amino}carbonyl)-1-isopropyl-1-H-pyrrol-3-yl]-4-[(3,3-dimethylbutanoyl)amino]-1-methyl-1H-pyrrole-2-carboxamide; oligopeptides; competitive binding |
| 05/24/2007 | US20070117759 Blister pack and solid dosage form therefor |
| 05/24/2007 | US20070117758 Treating treating angiogenic disease, e.g., cancer, by administering therapeutically effective amount of compounds of the invention, for example, {(3R, 4S, 5S, 6R)-5-Methoxy-4-[(2R, 3R)-2-methyl-3-(3-methyl-but-2-enyl)-oxiranyl]-1-oxa-spiro[2.5]oct-6-yloxycarbonylamino}-3-methyl-butyric acid methyl ester |
| 05/24/2007 | US20070117757 Polypeptide copolymer for use in treatment of multiple sclerosis; glatiramer acetate; copolymer-1 substantially free of species having a molecular weight of over 40 kilodaltons; chromatographic separation; cleaving by acid hydrolysis or enzymetic hydrolysis; isolation by dialysis or ultrafiltration, |
| 05/24/2007 | US20070117756 FVII or FVIIa Gla domain variants |
| 05/24/2007 | US20070117755 Gene fusion between soluble receptor with a ligand binding domain and a trimerization tag from the C-propeptide domain of pro-collagen, which iscapable of self-assembly into a covalently linked trimer; more potent blocker than dimeric TNF receptor decoys in inhibiting TNF- alpha inflammatory disease |
| 05/24/2007 | US20070117754 Nectin polypeptides, polynucleotides, methods of making and use thereof |
| 05/24/2007 | US20070117753 Contacting a cell with a peptide compound capable of inducing a conformational change in Bcl-2; converting the Bcl-2 into a pro-apoptotic form |
| 05/24/2007 | US20070117752 Glucagon-like-peptide-2 (GLP-2) analogues |
| 05/24/2007 | US20070117751 Compositions and methods for diagnosing and treating cancer |
| 05/24/2007 | US20070117750 Method for enhanced ocular drug penetration |
| 05/24/2007 | US20070117749 Production of mersacidin and its variants in SigH and/or mrsA negative bacillus host cells |
| 05/24/2007 | US20070117748 Novel apoptosis-modulating proteins, dna encoding the proteins and methods of use thereof |
| 05/24/2007 | US20070117747 Treating disorders of the nervous system |
| 05/24/2007 | US20070117746 Treatment of viral infections |
| 05/24/2007 | US20070117745 Cardio myopeptidin, the production and the use thereof |
| 05/24/2007 | US20070117744 nanoparticles comprising taxane and albumin, edetate, and sucrose; lyophilization; side effect reduction |
| 05/24/2007 | US20070117743 New antitumoral compounds |
| 05/24/2007 | US20070117742 producing a fraction enriched in a proteinaceous molecule having N-linked glycans comprising sialyl-Lewis X, Lewis X or LacdiNac structures; cerebral ischemia or myocardial infarction; composition comprising erythropoietin molecules |
| 05/24/2007 | US20070117741 An isolated polypeptide comprising SEQ. ID. NO. 1 and an excipient as a defensin-stumulating composition; fusion proteins; microbiocides; fungicides; mouth wash; toothpaste; films; cornea; eyedrops or -cream; skin creams and lotions;side effect reduction |
| 05/24/2007 | US20070117197 Lactobacilli expressing biologically active polypeptides and uses thereof |
| 05/24/2007 | US20070117196 Transformed microorganism comprising an isolated fragment of DNA derived from coffee and integrated into the genome or plasmid of the mannase; involved in the hydrolysis of polysaccharides |
| 05/24/2007 | US20070117189 Viral material and nucleotide fragments associated with multiple sclerosis, for diagnostic, prophylactic and therapeutic purposes |
| 05/24/2007 | US20070117184 In vivo incorporation of unnatural amino acids |
| 05/24/2007 | US20070117180 Enzyme producing plasma protein fragment having inhibitory activity to metastasis and growth of cancer and plasma protein fragment produced by fragmentation by said enzyme |
| 05/24/2007 | US20070117176 Process for the extraction of atelopeptide collagen from a collagenous source by microbial treatment |
| 05/24/2007 | US20070117166 Use of ULIP proteins in the diagnosis and therapy of cancers and paraneoplastic neurological syndromes |
| 05/24/2007 | US20070117162 Kidney-specific urate transporter and gene thereof |
| 05/24/2007 | US20070117161 Antibody Specific for Human 4-1BB Receptor |
| 05/24/2007 | US20070117159 Isolated polypeptide comprising a claimed amino acid sequence |
| 05/24/2007 | US20070117157 Parathyroid hormone-like polypeptides |
| 05/24/2007 | US20070117154 Combinatorial Synthesis of Libraries of Macrocyclic Compounds Useful in Drug Discovery |
| 05/24/2007 | US20070117142 Regulation of novel human asparagine-hydroxylases |
| 05/24/2007 | US20070117141 Identification and cloning of a full-length human clnk-related gene, MIST (mast cell immunoreceptor signal transducer) |
| 05/24/2007 | US20070117131 Processes for the replication of influenza viruses in cell culture, and the influenza viruses obtainable by the process |
| 05/24/2007 | US20070117129 Antigen arrays for treatment of bone disease |
| 05/24/2007 | US20070117124 Achaete-Scute Like-2 Polypeptides and Encoding Nucleic Acids and Methods for the Diagnosis and Treatment of Tumor |
| 05/24/2007 | US20070117097 Novel proteins and novel genes encoding the same |
| 05/24/2007 | US20070116784 Imatinib combinations for head and neck cancers |
| 05/24/2007 | US20070116778 Antibacterial, antiviral, and antifungal nutritional supplement: a combination of natural or neutraceutical compounds shown to have antibacterial, antiviral, and antifungal properties, to help boost the immune system in humans, and to protect against certain biowarfare diseases |
| 05/24/2007 | US20070116776 Particulate drug-containing products and method of manufacture |
| 05/24/2007 | US20070116772 Treating diabetes by orally administering insulin containing nanoparticles with a chitosan substrate and polyglutamic acid; may also contain a paracellular transport enhancer such as a Ca2+chelator. |
| 05/24/2007 | US20070116768 Sustained release preparations composed of biocompatible complex microparticles |
| 05/24/2007 | US20070116750 Compositions for disrupting and inhibiting reconstitution of wound biofilm |
| 05/24/2007 | US20070116738 Subcutaneous implants having limited initial release of the active principle and subsequent linearly varying extended release thereof |
| 05/24/2007 | US20070116726 Immunisation against Chlamydia pneumoniae |
| 05/24/2007 | US20070116723 Topically applied clostridium botulinum toxin compositions and treatment methods |
| 05/24/2007 | US20070116721 Hepatitis B virus pre-S1 derived synthetic polypeptides and uses thereof |
| 05/24/2007 | US20070116707 Antibody and antibody fragments for inhibiting the growth of tumors |
| 05/24/2007 | US20070116705 NOVEL PDEs AND USES THEREOF |
| 05/24/2007 | US20070116702 Survival promoting NCAM binding and MCAM ligand binding compounds |
| 05/24/2007 | US20070116700 For subcutaneous administration; hypertonic; useful for preventing self-association of reconstituted lyophilized formulations |
| 05/24/2007 | US20070116699 Nattokinase for reducing whole blood viscosity |
| 05/24/2007 | US20070116698 Novel methods and medicament for treating infectious diseases involving microbial biofilms |
| 05/24/2007 | US20070116697 Nanosphere/microsphere delivery system for the treatment of spinal cord injury |
| 05/24/2007 | US20070116696 Lotus and methyl donors |
| 05/24/2007 | US20070116695 Pharmaceutical preparations for attention deficit disorder, attention deficit hyperactivity disorder and other associated disorders |
| 05/24/2007 | US20070116694 Inhibitor of interaction of granzyme b with golgin-160 |
| 05/24/2007 | US20070116689 LIM mineralization protein splice variants |
| 05/24/2007 | US20070116688 Methods of organ regeneration |
| 05/24/2007 | US20070116687 Method of modulating cellular transmigration and agents for use therein |
| 05/24/2007 | US20070116677 administering secretoneurin intracerebrally into an affected area and the brain tissue damage is caused by cerebral ischemia or stroke; a 33-amino acid neuropeptide (TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ: SEQ ID NO: 1) |
| 05/24/2007 | US20070116675 Drug and method for proliferating natural killer cells |
| 05/24/2007 | US20070116673 fusion proteins; membrane proteins; cancer, metastasis |
| 05/24/2007 | US20070116672 Treatment of rheumatic diseases |
| 05/24/2007 | US20070116671 Cell and enzyme compositions for modulating bile acids, cholesterol and triglycerides |
| 05/24/2007 | US20070116669 Interferon-inducible protein-10 (IP-10 or CXCL10) chemokine analogs for the treatment of human diseases |
| 05/24/2007 | US20070116668 Lymphotoxin-beta, lymphotoxin-beta Complexes, pharmaceutical preparations and therapeutic uses thereof |
| 05/24/2007 | US20070116659 Elastase inhibitor |
| 05/24/2007 | US20070116644 Detectable labeled cobalamin (adenosylcolbalamin) conjugated with peptidesor amino acid residues linked to a chelate compound (ETDA) including a metal radionuclide;antitumor, anticarcinogenic agents; contrast agent for imaging; diagnosis; nontoxic;bioavailability; detectable at low concentrations |
| 05/24/2007 | DE102006013624A1 Glucose isomerase optionally in combination with 5-D-fructose-dehydrogenase, useful in/as medicine (product) for treating or diagnosing fructose intolerance |
| 05/24/2007 | DE102006013623A1 Mittel zur Verminderung des verwertbaren Kaloriengehalts der Nahrung und zur therapeutischen Gewichtsabnahme. Means for reducing the calorie content of the food and usable for therapeutic weight loss. Insbesondere zur Anwendung bei Adipositas (Fettsucht) In particular, for use in obesity (obesity) |
| 05/24/2007 | DE102005056103A1 Agent, useful to treat diabetes, comprises 5-D-fructose-dehydrogenase and glucose isomerase |
| 05/24/2007 | DE102005054937A1 Angiogenese förderndes Substrat Angiogenesis-promoting substrate |
| 05/24/2007 | CA2669549A1 Compositions of alpha-fetoprotein and inducers of apoptosis for the treatment of cancer |
| 05/24/2007 | CA2630559A1 Modified pore-forming protein toxins and use thereof |
| 05/24/2007 | CA2630497A1 Lipopeptide compositions |
| 05/24/2007 | CA2630323A1 Random copolymer compositions for treating unwanted immune response |
| 05/24/2007 | CA2630200A1 Uses for camki i and hdacs in the treatment of heart conditions |
| 05/24/2007 | CA2630175A1 Pharmaceutical composition for treating or preventing ovarian cancer |
| 05/24/2007 | CA2630085A1 Methods of regulating renalase (monoamine oxidase c) |
| 05/24/2007 | CA2630012A1 Targeted fusion proteins for cancer therapy |
| 05/24/2007 | CA2630011A1 Skin repair accelerating therapeutic agent containing desacyl ghrelin and derivatives thereof as active ingredient |
| 05/24/2007 | CA2630006A1 Skin repair accelerating therapeutic agent containing ghrelin and derivatives thereof or substance acting on ghs-r1a as active ingredient |
| 05/24/2007 | CA2629897A1 Novel hydrogels and uses thereof |
| 05/24/2007 | CA2629683A1 Medicament for use in connection with cartilage impairment |
| 05/24/2007 | CA2629635A1 Compositions of and methods of using stabilized psma dimers |
| 05/24/2007 | CA2629491A1 Compositions and methods for modulating hemostasis |
| 05/24/2007 | CA2629294A1 Method for treating disease or disorder of adult central nervous system associated with tissue shrinkage or atrophy by administration of insulin |