| Patents for A61K 35 - Medicinal preparations containing material or reaction products thereof with undetermined constitution (125,838) |
|---|
| 05/29/2007 | US7223593 Anticancer agents; gene coding immunomoderator cytokine protein |
| 05/29/2007 | US7223591 Strain of lactic acid bacterium and edible compositions, drugs and veterinary products containing it |
| 05/29/2007 | US7223585 Viral purification methods |
| 05/29/2007 | US7223543 Conjugated linoleic acid isomerase and a process for the production of conjugated linoleic acid |
| 05/29/2007 | US7223542 Diagnosing cancer via determining concentration of marker polypeptides; genetic vaccines; antiproliferative/antitumor agents |
| 05/29/2007 | US7223423 Skin-care and hair care composition of cumin, cloves, olibanum, eagle wood, and giant hyssop; cleanser, a deodorant, treating skin problems, wrinkles, skin sagging, dark spots, skin infections, skin irritation, cuts, scarring, acne, cold sores |
| 05/29/2007 | US7223422 Intraarticularly injecting a fluid in the joint space of an animal; the replacement fluid is synovial fluid that has been harvested from other animals and processed to remove impurities, cellular and pathogenic components, then lyophilized, packaged and reconstituted |
| 05/29/2007 | US7223391 Administering subject's modified blood on consecutive days; blood is modified extracorporeally by exposure from 2 to 5 minutes to a combination of stressors; treating ischemic stress, atherosclerosis and rheumatoid arthritis |
| 05/29/2007 | US7223389 Compositions and methods for treatment of cancer |
| 05/29/2007 | US7223388 Reoviridae virus is conjugated to a hydroxylated hydrocarbon or a polycationic polymer to reduce the clearance and immunogenicity; antiproliferative disorders |
| 05/29/2007 | US7223346 A centrifugal spin-separator with a float in the cavity that has a density between the erythrocytes and plasma and moves through the sedimenting erythrocytes during centrifugation and releases trapped platelets |
| 05/29/2007 | CA2154368C Therapeutic applications of chimeric organogenesis |
| 05/28/2007 | CA2569326A1 Compositions and methods to create a vascularized environment for cellular transplantation |
| 05/24/2007 | WO2007059491A2 Novel hydrogels and uses thereof |
| 05/24/2007 | WO2007059431A1 Use of an omega-3 lipid-based emulsion following ischemic injury to provide protection and recovery in human organs |
| 05/24/2007 | WO2007058934A2 Methods and compositions for treating basement membrane disorders |
| 05/24/2007 | WO2007058404A1 Multipotent stem cells derived from human adipose tissue and cellular therapeutic agents comprising the same |
| 05/24/2007 | WO2007058105A1 Method for producing pancreas from es cell |
| 05/24/2007 | WO2007058027A1 Harmful bacterium control agent containing bacillus thuringiensis |
| 05/24/2007 | WO2007057907A2 Device and method for cell grafting |
| 05/24/2007 | WO2007057763A2 Nitric oxide as an anti-viral agent, vaccine and vaccine adjuvant |
| 05/24/2007 | WO2007056854A1 Method of expanding double negative t cells |
| 05/24/2007 | WO2007039313A3 Probiotic enterococci for improved immunity |
| 05/24/2007 | WO2007038933A3 A method for producing cells with efficient engraftment within the heart |
| 05/24/2007 | WO2007034071A3 Method for preparing a sample |
| 05/24/2007 | WO2007017914A3 Dermonecrotizing protein factors of bacterial origin and related uses in medical field |
| 05/24/2007 | US20070117766 Vigilant cells |
| 05/24/2007 | US20070117205 Hepatoblasts and method of isolating same |
| 05/24/2007 | US20070117197 Lactobacilli expressing biologically active polypeptides and uses thereof |
| 05/24/2007 | US20070117189 Viral material and nucleotide fragments associated with multiple sclerosis, for diagnostic, prophylactic and therapeutic purposes |
| 05/24/2007 | US20070117180 Enzyme producing plasma protein fragment having inhibitory activity to metastasis and growth of cancer and plasma protein fragment produced by fragmentation by said enzyme |
| 05/24/2007 | US20070117142 Regulation of novel human asparagine-hydroxylases |
| 05/24/2007 | US20070116779 Comprehensive nutraceutical agent for treatment/ prevention of Parkinson's disease |
| 05/24/2007 | US20070116778 Antibacterial, antiviral, and antifungal nutritional supplement: a combination of natural or neutraceutical compounds shown to have antibacterial, antiviral, and antifungal properties, to help boost the immune system in humans, and to protect against certain biowarfare diseases |
| 05/24/2007 | US20070116750 Compositions for disrupting and inhibiting reconstitution of wound biofilm |
| 05/24/2007 | US20070116698 Novel methods and medicament for treating infectious diseases involving microbial biofilms |
| 05/24/2007 | US20070116693 Bacterial culture having effects of suppressing dermatitis development and accelerating skin wound healing, and product using the same |
| 05/24/2007 | US20070116692 Host cells obtained by introducing and expressing VHL gene in cancer cells or embryonic stem cells |
| 05/24/2007 | US20070116689 LIM mineralization protein splice variants |
| 05/24/2007 | US20070116688 Methods of organ regeneration |
| 05/24/2007 | US20070116686 Method for separating precursor cells producing gabaergic neuron alone |
| 05/24/2007 | US20070116685 Endothelial progenitor cells that express CD31 and c-kit, and not more than one percent express Tie-2 antigen; cell therapy for eye disorders |
| 05/24/2007 | US20070116684 Methods of isolation, expansion and differentiation of fetal stem cells from chorionic villus, amniotic fluid, and placenta and therapeutic uses thereof |
| 05/24/2007 | US20070116683 Methods of isolation, expansion and differentiation of fetal stem cells from chorionic villus, amniotic fluid, and placenta and therapeutic uses thereof |
| 05/24/2007 | US20070116682 Methods of isolation, expansion and differentiation of fetal stem cells from chorionic villus, amniotic fluid, and placenta and therapeutic uses thereof |
| 05/24/2007 | US20070116681 Ex vivo and in vivo methods and related compositions for generating hematopoietic stem cell populations |
| 05/24/2007 | US20070116680 Stem cells within gel microenvironments |
| 05/24/2007 | US20070116679 Augmentation of organ function |
| 05/24/2007 | US20070116678 Medical device with living cell sheet |
| 05/24/2007 | US20070116677 administering secretoneurin intracerebrally into an affected area and the brain tissue damage is caused by cerebral ischemia or stroke; a 33-amino acid neuropeptide (TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ: SEQ ID NO: 1) |
| 05/24/2007 | US20070116676 Method for three-dimensional cartilage tissue engineering using bone marrow cells in tissue engineering bone marrow cells in simulated microgravity environment |
| 05/24/2007 | US20070116675 Drug and method for proliferating natural killer cells |
| 05/24/2007 | US20070116674 Use of adipose tisue cells for initiating the formation of a fuctional vascular network |
| 05/24/2007 | US20070116671 Cell and enzyme compositions for modulating bile acids, cholesterol and triglycerides |
| 05/24/2007 | US20070116670 providing a medicament for the therapy of YB-1 positive diseases, in particular of tumor diseases; expressing a gene or gene fragment in a tumor cell |
| 05/24/2007 | US20070113355 Composite materials |
| 05/24/2007 | DE60119515T2 Probiotica für verwendung als haustierfutter Probiotics for use as petfood |
| 05/24/2007 | DE202007002615U1 Badepoolanordnung mit Wasser, das mit Nano-Ozonkugeln zur Rehabilitation gefüllt ist Swimming pool arrangement with water that is filled with nano-ozone balls for rehabilitation |
| 05/24/2007 | CA2629532A1 Method of expanding double negative t cells |
| 05/24/2007 | CA2627974A1 Methods of treating fibrosing diseases by induction of immune tolerance |
| 05/23/2007 | EP1788085A1 A gene differentially expressed in breast and bladder cancer and encoded polypeptides |
| 05/23/2007 | EP1787651A1 Bacterial culture having effects of suppressing dermatitis development and accelarating skin wound healing, and product using the same |
| 05/23/2007 | EP1786829A1 Process for isolating biomaterial from tissue and an isolated biomaterial extract prepared therefrom |
| 05/23/2007 | EP1786519A1 Flavopereirine and alstonine combinations in the treatment and prevention of prostate cancer |
| 05/23/2007 | EP1786485A2 Surface directed cellular attachment |
| 05/23/2007 | EP1786470A2 Nucleic acid constructs and cells, and methods utilizing same for modifying the electrophysiological function of excitable tissues |
| 05/23/2007 | EP1786456A1 Use of apo2l receptor agonists and nk cells or nk cell activators |
| 05/23/2007 | EP1786445A2 Live microbial microbicides |
| 05/23/2007 | EP1786444A1 Intradiscal production of autologous interleukin receptor antagonist |
| 05/23/2007 | EP1786428A2 Pde5 inhibitor compositions and methods for treating cardiac indications |
| 05/23/2007 | EP1786273A2 Sequential protein isolation and purirication schemes by affinity chromatography |
| 05/23/2007 | EP1307537B1 Neospora caninum isolate |
| 05/23/2007 | EP1177157B1 A vital matter and a producing method |
| 05/23/2007 | EP1175221B1 Lactic acid bacteria with anxiolytic properties and uses thereof |
| 05/23/2007 | EP0820469B1 Identification, purification and uses of leczymes and carbohydrate ligands |
| 05/23/2007 | CN1969040A Method for making high purity cardiomyocyte preparations suitable for regenerative medicine |
| 05/23/2007 | CN1969039A Tissue material and muscle derived matrix |
| 05/23/2007 | CN1968959A 流行性感冒治疗 Influenza treatment |
| 05/23/2007 | CN1968608A Improved modalities for the treatment of degenerative diseases of the retina |
| 05/23/2007 | CN1966684A Construction of HER2/neu mRNA in vitro transcription vector and use thereof |
| 05/23/2007 | CN1966675A Non-human mammal embryonic tissue cell suitable for cell transplantation, its preparation method and application |
| 05/23/2007 | CN1966068A Transfer factor solution containing cluster water used for animals |
| 05/23/2007 | CN1966067A Medicament for treating aplastic anemia |
| 05/23/2007 | CN1966065A Chinese herbal pill for treating hepatitis B |
| 05/23/2007 | CN1966062A Medicinal decoction for treating urticaria occurred in menstrual period and preparation process thereof |
| 05/23/2007 | CN1966060A Drink for protecting wrist |
| 05/23/2007 | CN1966059A Drink for treating bone fracture |
| 05/23/2007 | CN1966058A Drink for preventing miscarriage |
| 05/23/2007 | CN1966057A Externally applied Chinese medicinal liquid for preventing and treating chilblain |
| 05/23/2007 | CN1966055A Medicament for treating chronic bronchitis and preparation method thereof |
| 05/23/2007 | CN1966053A Medicament for removing freckles |
| 05/23/2007 | CN1966050A Medicament for treating heart disease and preparation process thereof |
| 05/23/2007 | CN1966049A Medicinal decoction for treating liver constraint restraining spleen type amenorrhvea |
| 05/23/2007 | CN1966048A Chinese medicinal formulation for treating apoplexy sequelae |
| 05/23/2007 | CN1966043A Externally applied medicament for treating hyperplasia of mammary glands and preparation method thereof |
| 05/23/2007 | CN1966042A Externally applied ointment for treating hyperosteogeny and preparation method thereof |
| 05/23/2007 | CN1966041A Chinese medicinal formulation for treating depression |
| 05/23/2007 | CN1966040A Chinese medicinal decoction for treating gastrointestinal diseases |
| 05/23/2007 | CN1966036A Chinese medicine for treating gastrointestinal disease and preparation method thereof |
| 05/23/2007 | CN1966035A Chinese medicinal formulation for treating children's hyperkinetic syndrome |